GLP-1 moiety from Dulaglutide
Based on 1 Customer Validation
GLP-1 moiety from Dulaglutide ([Gly8,36,Glu22]-GLP-1 (7-37)) is a 31-amino acid fragment derived from Dulaglutide (HY-P0120). GLP-1 moiety from Dulaglutide is a DPP-4-modified GLP-1 analog carrying the [Gly8,36,Glu22] sequence mutation, which acts as a GLP-1 receptor agonist. GLP-1 moiety from Dulaglutide covalently links to the human IgG4 Fc fragment and constitutes a part of the dulaglutide recombinant fusion protein. GLP-1 moiety from Dulaglutide exhibits glucose-dependent insulinotropic activity. GLP-1 moiety from Dulaglutide can be used in research related to type 2 diabetes.
For research use only. We do not sell to patients.
- Purity : 99.60%
- CAS No.: 1197810-60-8
- Formula: C149H221N37O49
- Molecular Weight:3314.62
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Description
In Vitro
GLP-1 moiety from Dulaglutide ([Gly8,36,Glu22]-GLP-1 (7-37)), when incorporated into the optimized dulaglutide GLP-1-Fc fusion protein expressed in HEK293-EBNA cells, contributes to a 4-fold greater in vitro activity than the corresponding free DPP-4-protected GLP-1 analog[4].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Further protocols information, click here.
Chemical Information
-
CAS No. 1197810-60-8
-
Appearance Solid
-
Molecular Weight 3314.62
-
Formula C149H221N37O49
-
Color White to off-white
-
Synonyms
[Gly8,36,Glu22]-GLP-1 (7-37)
-
Sequence Shortening
HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
DMSO : 1.96 mg/mL (0.59 mM; ultrasonic and adjust pH to 2 with 1 M HCl; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : < 0.1 mg/mL (insoluble)
Protocols
-
Research Protocol for Metabolic Diseases
AMP-activated protein kinase, AMPK, is a conserved cellular energy sensor that responds to reduced cellular energy status and coordinates metabolism by increasing ATP-generating catabolic pathways while suppressing ATP-consuming anabolic processes. In metabolic disease research, the AMPK pathway is experimentally relevant because it regulates hepatic lipid synthesis, fatty acid oxidation, glucose production, skeletal-muscle glucose disposal, mTORC1-linked biosynthesis, autophagy, mitochondrial homeostasis, and whole-body energy balance. The central pathway logic is that energy stress, metformin, exercise-like stimulation, or direct AMPK activators increase AMPKα Thr172 phosphorylation and downstream substrate phosphorylation, including ACC and RAPTOR. Phosphorylation of ACC suppresses lipogenesis and supports fatty acid oxidation, whereas phosphorylation of RAPTOR suppresses mTORC1 signaling and links cellular energy status to growth and protein synthesis control. The pathway is linked
-
Genotoxicity/Mutagenicity Study
The bacterial reverse mutation assay detects point mutations that restore amino-acid prototrophy in auxotrophic Salmonella typhimurium or Escherichia coli tester strains; after exposure to a test article, mutagenic activity is read out as an increased number of revertant colonies on minimal agar compared with the vehicle control. The assay uses tester strains with different mutation targets so that base-substitution and frameshift mutagens can be detected, and testing is performed with and without exogenous mammalian metabolic activation because some chemicals require biotransformation to become mutagenic.
Purity & Documentation
-
Data Sheet (268 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Celeste A, et al. Anti-PCSK9-GLP-1 fusions and methods for use. US20160369010 A1. 2016 Dec 22.
[2]. Xi L, et al. Dulaglutide accelerates diabetic wound healing by suppressing Nrf2-dependent ferroptosis in diabetic mice. Peptides. 2025 Mar;185:171366. [Content Brief]
[3]. Wang R, et al. Dulaglutide Alleviates LPS-Induced Injury in Cardiomyocytes. ACS omega. 2021 Mar 30;6(12):8271-8278. [Content Brief]
[4]. Jimenez-Solem E, et al. Dulaglutide, a long-acting GLP-1 analog fused with an Fc antibody fragment for the potential treatment of type 2 diabetes. Current opinion in molecular therapeutics. 2010 Dec;12(6):790-7. [Content Brief]
[5]. Lorenz M, et al. Recent progress and future options in the development of GLP-1 receptor agonists for the treatment of diabesity. Bioorganic & medicinal chemistry letters. 2013 Jul 15;23(14):4011-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)