Nagrestipen
Nagrestipen, a human macrophage inflammatory protein-1 alpha (MIP-1α) variant, also known as ECI 301. Nagrestipen has antitumor activity and can be used in therapeutic trials to study cancer, tumors, metastases, radiation oncology, and tumor metastasis.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- CAS No.: 166089-33-4
- Formule: C338H516N88O108S4
- Masse moléculaire:7668.48
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
- Pureté et documentation
- Références
-
Help & FAQs
Activité biologique
Nagrestipen (ECI 301) (i.v; 0.08, 0.4, 2 μg; day 1,8,15) can inhibit tumor growth in a dose-dependent manner at both irradiated and unirradiated sites of female C57BL/6 with LLC cells[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Male BALB/c mice with Colon26 cells and MethA cells[1]
-
Dosage:2 μg
-
Administration:Intravenous injection; daily for 5 days
-
Result:Significantly inhibited tumor size without significant toxicity.
Stopped tumor growth in the colon not only at the irradiated site but also at the unirradiated.
Chemical Information
-
CAS No. 166089-33-4
-
Masse moléculaire 7668.48
-
Formule C338H516N88O108S4
-
Sequence Shortening
SLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA (Disulfide bridge:Cys10-Cys34;Cys11-Cys50)
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureté et documentation
Références
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Nagrestipen Related Classifications
HY-P3627 Related Classifications
Powered by Bioz