Nagrestipen
Nagrestipen, a human macrophage inflammatory protein-1 alpha (MIP-1α) variant, also known as ECI 301. Nagrestipen has antitumor activity and can be used in therapeutic trials to study cancer, tumors, metastases, radiation oncology, and tumor metastasis.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- CAS. Nr.: 166089-33-4
- Formel: C338H516N88O108S4
- Molecular Weight:7668.48
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biologische Aktivität
Nagrestipen (ECI 301) (i.v; 0.08, 0.4, 2 μg; day 1,8,15) can inhibit tumor growth in a dose-dependent manner at both irradiated and unirradiated sites of female C57BL/6 with LLC cells[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Male BALB/c mice with Colon26 cells and MethA cells[1]
-
Dosage:2 μg
-
Administration:Intravenous injection; daily for 5 days
-
Result:Significantly inhibited tumor size without significant toxicity.
Stopped tumor growth in the colon not only at the irradiated site but also at the unirradiated.
Chemical Information
-
CAS. Nr. 166089-33-4
-
Molecular Weight 7668.48
-
Formel C338H516N88O108S4
-
Sequence Shortening
SLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA (Disulfide bridge:Cys10-Cys34;Cys11-Cys50)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Reinheit & Dokumentation
Verweise
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)