1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. Cyclophilin A Protein, Mouse

Cyclophilin A protein catalyzes the isomerization of proline imide peptide bonds in oligopeptides. Cyclophilin A Protein, Mouse is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg Get quote
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Cyclophilin A protein catalyzes the isomerization of proline imide peptide bonds in oligopeptides. Cyclophilin A Protein, Mouse is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with tag free.

Background

Cyclophilin A catalyzes the cis-trans isomerization of proline imidic peptide bonds, exerting a potent chemotactic effect on leukocytes through the activation of its membrane receptor BSG/CD147 and initiating a signaling cascade culminating in MAPK/ERK activation. This protein activates endothelial cells (ECs) in a pro-inflammatory manner by stimulating NF-kappa-B and MAP-kinase signaling, inducing the expression of adhesion molecules like SELE and VCAM1. Moreover, Cyclophilin A induces apoptosis in ECs by promoting FOXO1-dependent expression of CCL2 and BCL2L11. In response to oxidative stress, it initiates both proapoptotic and antiapoptotic signaling pathways in ECs through NF-kappa-B activation, AKT1 up-regulation, and BCL2 induction. It negatively regulates MAP3K5/ASK1 kinase activity and is essential for the assembly of TARDBP in heterogeneous nuclear ribonucleoprotein complexes, thereby influencing TARDBP binding to RNA and the expression of HDAC6, ATG7, and VCP, crucial for protein aggregate clearance. Cyclophilin A also plays a pivotal role in platelet activation and aggregation, regulates calcium mobilization, integrin ITGA2B:ITGB3 bidirectional signaling, and binds heparan sulfate glycosaminoglycans.

Biological Activity

Measured by its ability to inhibit calcineurin phosphatase activity in the presence of Cyclosporin A. The IC50 for inhibition of calcineurin activity is 530.199 nM that incubate at 37 ºC for 60 minutes.

Assay Procedure

Materials
Assay buffer: 20 mM Tris, 10 mM MgCl2, 0.1 mM CaCl2, 1 mg/mL BSA, pH 7.5
Test protein:Cyclophilin A Protein, Mouse (HY-P70007A, CYPA)
Calcineurin Protein, Human
Calmodulin Protein, Human (HY-P7710)
Substrate: Serine/Threonine Phosphatase Substrate I, 10 mM stock solution in deionized water
Cyclosporin A, 1 mM stock solution in DMSO
Malachite Green Phosphate Assay Kit

Procedure
1. Dilute Calcineurin to 1.17 μg/mL, Calmodulin to 16.8 μg/mL, and Cyclosporin A to 30 μM in the assay buffer.
2. Dilute Human CYPA to the following concentrations: 20000, 10000, 5000, 2500, 1250, 625, 313, 156, 78, 39, and 20 nM.
3. Add the following to the microplate wells:
Sample group: 5 μL of Human CYPA dilution, 5 μL Calmodulin, 5 μL of Cyclosporin A, 25 μL of Calcineurin.
Control group: 5 μL of assay buffer, 5 μL Calmodulin, 5 μL of Cyclosporin A, 25 μL of Calcineurin.
4. Seal the plate, mix by tapping, and incubate at room temperature for 1 hour.
5. After incubation, remove the seal and add 10 μL of 1 mM substrate. The total volume should be 50 μL.
6. Re-seal the plate and incubate with shaking at 37°C for 1 hour. Adjust the volume to 200 μL with assay buffer.
7. Add 70 μL of chromogenic reagent to each well, gently mix by pipetting up and down, and allow to stand at room temperature for 30 minutes.
8. Measure at 630 nm (absorbance) in endpoint mode.
9. Determine the 50% inhibitory concentration (IC50).

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P17742 (M1-L164)

Gene ID
Molecular Construction
N-term
Cyclophilin A (M1-L164)
Accession # P17742
C-term
Protein Length

Full Length

Synonyms
rMuPeptidyl-prolyl cis-trans isomerase A/Cyclophilin A; Peptidyl-prolyl cis-trans isomerase A; PPIase A; Cyclophilin A; Cyclosporin A-binding protein; Rotamase A; SP18; PPIA; CYPA
AA Sequence

MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL

Predicted Molecular Mass
18 kDa
Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Cyclophilin A Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Cyclophilin A Protein, Mouse

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cyclophilin A Protein, Mouse
Cat. No.:
HY-P70007A
Quantity:
MCE Japan Authorized Agent: