IFN-beta Protein, Mouse (HEK293)

12 Cited Publications
Customer Review

Based on 12 publication(s) in Google Scholar

IFN-beta is a secretory cytokine produced by cells under viral infection or nucleic acid stimulation. IFNβ binds to cell surface heterodimeric receptors (IFNAR1/IFNAR2), activates the JAK-STAT signaling pathway, and induces the expression of interferon-stimulated genes (ISGs) (such as PKR, 2'5'-OAS). IFN-beta inhibits viral proliferation, regulates immune responses (such as inhibiting Th1 cell polarization, reducing pro-inflammatory cytokine secretion), inhibits the proliferation of vascular smooth muscle cells and tumor cells. IFN-beta has anti-atherosclerotic and vascular remodeling effects. Mouse (HEK293) is the recombinant mouse-derived IFN-beta protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IFN-beta is a secretory cytokine produced by cells under viral infection or nucleic acid stimulation. IFNβ binds to cell surface heterodimeric receptors (IFNAR1/IFNAR2), activates the JAK-STAT signaling pathway, and induces the expression of interferon-stimulated genes (ISGs) (such as PKR, 2'5'-OAS). IFN-beta inhibits viral proliferation, regulates immune responses (such as inhibiting Th1 cell polarization, reducing pro-inflammatory cytokine secretion), inhibits the proliferation of vascular smooth muscle cells and tumor cells. IFN-beta has anti-atherosclerotic and vascular remodeling effects. Mouse (HEK293) is the recombinant mouse-derived IFN-beta protein, expressed by HEK293 , with tag free.

Background

IFN-beta belongs to the type I interferon family[2][3][7]. IFN-beta is a secreted cytokine produced by cells in response to viral infection or nucleic acid stimulation[2][5][7]. IFN-beta binds to cell surface heterodimeric receptors (IFNAR1/IFNAR2), activates the JAK-STAT signaling pathway, and induces the expression of interferon-stimulated genes (ISGs) (such as PKR, 2'5'-OAS)[2][3][4][7]. IFN-beta inhibits viral proliferation, regulates immune responses (such as inhibiting Th1 cell polarization and reducing the secretion of pro-inflammatory cytokines), inhibits the proliferation of vascular smooth muscle cells and tumor cells. IFN-beta has anti-atherosclerotic and vascular remodeling effects[2][5][6][7]. IFN-beta is expressed in tissues such as the spleen, lungs, and kidneys, as well as in vascular endothelial cells and immune cells[5][7]. IFN-beta Protein, Mouse has 50% sequence identity to human IFN-beta[8].

In Vivo

IFN-beta Protein, Mouse (10000 IU/mouse; i.p.; daily; 5 days) enhances DHPG (HY-12598A)-mediated protection against HSV-2 systemic infection in Swiss Webster mice, reducing mortality[6].
IFN-beta Protein, Mouse (10 MIU/kg; s.c.; daily; 4 weeks) attenuates Ang II-induced atherosclerotic plaque formation in apoE-/- mice, reducing lesion area in carotid artery by 30%[7].

Verified Bioactivity

1. Measured in antiviral assays using L929 cells infected with vesicular stomatitisvirus (VSV) and the ED50 is 3-18 pg/mL.
2. Determined by a cytotoxicity assay using human TF-1 cells. The ED50 this effect is ≤0.3901 ng/mL, corresponding to a specific activity is ≥2.563×106 units/mg.
3. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse IFNAR2 at 2 μg/mL (100 μL/well) can bind Biotinylated Recombinant Mouse IFN-beta. The ED50 for this effect is <5 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Determined by a cytotoxicity assay using human TF-1 cells. The ED50 for this effect is 0.3901 ng/mL, corresponding to a specific activity is 2.563×106 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IFN-beta (I22-N182)
      Accession # P01575
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IFNB1; IFF; Prev. IFNB; Fibroblast Interferon; IFB; IFN-Beta; Interferon Beta; Interferon-Beta; Interferon Beta 1; Interferon, Beta 1, Fibroblast

  • AA Sequence

    INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN

  • Predicted Molecular Mass

    19.7 kDa

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00