Copy Link Print Information

IFN-alpha 2/IFNA2 Protein, Mouse

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

IFN-alpha 2/IFNA2 Protein, synthesized by macrophages, exhibits potent antiviral activities. Its interaction with IFNAR2 plays a pivotal role in signaling processes, contributing to the intricate network of antiviral defense mechanisms. IFN-alpha 2/IFNA2 Protein, Mouse is the recombinant mouse-derived IFN-alpha 2/IFNA2 protein, expressed by E. coli, with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IFN-alpha 2/IFNA2 Protein, Mouse
  • Experimental Validation Results for IFN-alpha 2/IFNA2 Protein, Mouse
  • Experimental Validation Results for IFN-alpha 2/IFNA2 Protein, Mouse
  • Experimental Validation Results for IFN-alpha 2/IFNA2 Protein, Mouse
  • IFN-alpha 2/IFNA2 Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IFN-alpha 2/IFNA2 Protein, synthesized by macrophages, exhibits potent antiviral activities. Its interaction with IFNAR2 plays a pivotal role in signaling processes, contributing to the intricate network of antiviral defense mechanisms. IFN-alpha 2/IFNA2 Protein, Mouse is the recombinant mouse-derived IFN-alpha 2/IFNA2 protein, expressed by E. coli, with tag free.

Background

IFN-alpha 2/IFNA2, synthesized primarily by macrophages, possesses potent antiviral activities. Through its interaction with IFNAR2, it engages in crucial signaling processes, contributing to the intricate network of antiviral defense mechanisms.

Verified Bioactivity

1. Measured in a cell proliferation assay using TF-1 cells. The ED50 this effect is <0.5 ng/mL.
2. Measured by its binding ability in a functional ELISA. Immobilized Mouse IFNA2 at 2 μg/ml (100 μL/well) can bind Biotinylated Mouse IFNAR2. The ED50 for this effect is 30-40 ng/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    P01573 (C24-E190)

  • Gene ID
    15965  [NCBI]
  • Molecular Construction
    • N-term
    • IFNA2 (C24-E190)
      Accession # P01573
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IFNA2; IFN-Alpha-2; Interferon Alpha 2; IFNA2B; IFN-AlphaA; LeIF A; IFNA; Interferon Alpha 2a; Alpha-2a Interferon; Interferon Alpha-A; Interferon Alpha 2b; Interferon 1AB4; Interferon Alpha A; IFNA2C; Interferon Alpha-2; IFNA2A

  • AA Sequence

    CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE

  • Predicted Molecular Mass

    19.5 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM His-HCl, 6% sucrose, 4% mannitol, 0.02% Tween 80, pH 6.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using TF-1 cells. The ED50 this effect is 0.4718 ng/mL, corresponding to a specific activity is 2.12×106units/mg.

  • 1/16

    IFN-alpha 2/IFNA2 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cell Rep. 2024 Apr 23;43(4):114088. [Abstract]

    Customer Validation
     IFN-alpha 2/IFNA2 Protein, Mouse (IFNα) (0.1-100 ng/mL; 24 h) induced BST2 expression in BMDMs and THP-1 cells in a concentration-dependent manner.

  • 1/16

    IFN-alpha 2/IFNA2 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cell Rep. 2024 Apr 23;43(4):114088. [Abstract]

    Customer Validation
     mRNA and protein expression of BST2 in iBMDM cells treated with IFN-alpha 2/IFNA2 Protein, Mouse (IFNα) (50 ng/mL; 24 h).

  • IFN-alpha 2/IFNA2 Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for IFN-alpha 2/IFNA2 Protein, Mouse
  • Experimental Validation Results for IFN-alpha 2/IFNA2 Protein, Mouse
  • Experimental Validation Results for IFN-alpha 2/IFNA2 Protein, Mouse
  • Experimental Validation Results for IFN-alpha 2/IFNA2 Protein, Mouse
  • IFN-alpha 2/IFNA2 Protein, Mouse Product Image