IFN-alpha 2b/IFNA2 Protein, Human (P.pastoris)

IFN-alpha 2 (IFNA2), belongs to type I interferon family, is a protein secreted by cells infected by a virus and acting on other cells to inhibit viral infection^[1]. IFN-alpha 2 increases the frequencies of cytotoxic CD8⁺ T cells and induces CD4⁺ T cell depletion^[3]. IFN-alpha 2b/IFNA2 Protein, Human (P.pastoris) contains 165 a.a., is produced in yeast strain P. pastoris with tag free.

IFN-alpha 2 (IFNA2; IFN-α2), belongs to the type I interferon family, produced by the plasmacytoid dendritic cells (pDCs) exposure to HIV-1BaL in order to inhibit viral infection^[1].
Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively^[2].
IFN-alpha 2 subtype is the only one that is currently licensed to treat infections caused by hepatitis B virus (HBV) and HCV^[3].
IFN-alpha 2 shows a Sortilin-dependent trafficking in cells and increases the expression level of interferon-stimulated genes (ISGs) in HIV-infected cells^[1][4]. It also exhibits cytotoxic activity against CD8⁺ T cells and enhances CD4⁺ T cell depletion^[3].
Among the IFN-alpha 2 alleles, IFN-alpha 2b is being the predominant allele while IFNα-2a is less predominant and IFNα-2c only a minor allelic variant^[5].
IFN-alpha 2 has a bored application in research of cancer, including some hematological malignancies and solid tumors^[6]. As for a wildly use of IFN in animal disease model, the sequence of amino acids in IFNA2a protein of human is very different from mouse (59.57%).

IFNA2a (hydrodynamic injection with plasmids) leads to upregulation of interferon-stimulated genes (ISGs) and results HIV-1 induced CD4+ T cell depletion in the hu-PBL humanized mouse model^[3].

Measured in antiviral assays using WISH human amnion cells infected with vesicular stomatitis virus(VSV) and the EC₅₀ is typically 0.6-4.2 pg/mL.

Human

P. pastoris

Tag Free

P01563 (C24-E188)

3440  [NCBI]

Full Length of Mature Protein

CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Approximately 19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Abraham S, et al. Gene therapy with plasmids encoding IFN-β or IFN-α14 confers long-term resistance to HIV-1 in humanized mice. Oncotarget. 2016 Nov 29;7(48):78412-78420.  [Content Brief]

  [2]. Zhang SY, et al. Inborn errors of interferon (IFN)-mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40.  [Content Brief]