IL-10 Protein, Mouse

IL-10 protein is a key immunomodulator that, by binding to its heterotetrameric receptors (IL10RA and IL10RB), activates JAK1 and STAT2 (the latter phosphorylates STAT3), thereby triggering potent anti-inflammatory effects. Phosphorylated STAT3 translocates to the nucleus and promotes the expression of anti-inflammatory mediators. IL-10 Protein, Mouse is the recombinant mouse-derived IL-10 protein, expressed by E. coli , with tag free.

IL-10, a major immune regulatory cytokine, exerts profound anti-inflammatory functions, mitigating excessive tissue disruption caused by inflammation. Upon binding to its heterotetrameric receptor, comprising IL10RA and IL10RB, IL-10 initiates a signaling cascade involving JAK1 and STAT2-mediated phosphorylation of STAT3. Subsequently, phosphorylated STAT3 translocates to the nucleus, where it drives the expression of anti-inflammatory mediators. IL-10 specifically targets antigen-presenting cells (APCs), such as macrophages and monocytes, inhibiting their release of pro-inflammatory cytokines, including GM-CSF, G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8, and TNF-alpha. Additionally, IL-10 interferes with antigen presentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby dampening their ability to induce T cell activation. Furthermore, IL-10 controls the inflammatory response of macrophages by reprogramming essential metabolic pathways, including mTOR signaling. IL-10 exists as a homodimer and interacts with IL10RA and IL10RB.

Mouse IL-10 inhibits LPS-induced secretion of IL-6 by RAW264.7 cells. The ED₅₀ for this effect is <5 ng/mL in the presence of 2 μg/mL LPS.

• 
  Mouse IL-10 inhibits LPS-induced secretion of IL-6 by RAW264.7 cells. The ED₅₀ for this effect is 0.3491 ng/mL in the presence of 2 μg/mL LPS. Corresponding to a specific activity is 2.865×10⁶ U/mg.

Mouse

E. coli

Tag Free

P18893 (S19-S178)

16153  [NCBI]

Full Length of Mature Protein

SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<0.01 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.