MIF Protein, Human
Based on 10 publication(s) in Google Scholar
MIF Protein, Human has assumed an important role as a pivotal regulator of innate immunity. MIF Protein, Human promotes the pro-inflammatory functions of immune cells.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
MIF Protein, Human has assumed an important role as a pivotal regulator of innate immunity. MIF Protein, Human promotes the pro-inflammatory functions of immune cells.
Background
Macrophage Migration Inhibitory Factor (MIF) has assumed an important role as a pivotal regulator of innate immunity. MIF is an integral component of the host antimicrobial alarm system and stress response that promotes the pro-inflammatory functions of immune cells. MIF-directed therapies might offer new treatment opportunities for human diseases in the future[1].
Verified Bioactivity
Measured by its ability to inhibit THP-1 human acute monocyte migration .The ED50 this effect is ≤19.31 ng/mL, corresponding to a specific activity is ≥5.179×104 U/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (10)
-
Journal Impact Factor
-
Most Recent
-
-
Mol Med
MIF promotes Th17 cell differentiation in rheumatoid arthritis through ATF6 signal pathway. [Abstract]2024 Nov 29;30(1):237. PMID: 39614150
MIF Protein, Human purchased from MedChemExpress. Usage Cited in: Mol Med. 2024 Nov 29;30(1):237. [Abstract]
rhMIF (MIF Protein, Human: 200 ng/mL) was incubated with PBMCs from RA patients for 6 hours, CD4+ T cells were sorted, and protein lysate was extracted for Western blot experiments.
MIF Protein, Human purchased from MedChemExpress. Usage Cited in: Mol Med. 2024 Nov 29;30(1):237. [Abstract]
rhMIF (MIF Protein, Human: 200 ng/mL) was incubated with PBMCs from RA patients for 3 days, and the proportion of Th17 cells in the control and treatment groups was analyzed by flow cytometry.
-
Commun Biol
Biphasic protective effects of macrophage migration inhibitory factor in ischemia/reperfusion-induced acute kidney injury. [Abstract]2025 Jul 28;8(1):1112. PMID: 40721484
MIF Protein, Human purchased from MedChemExpress. Usage Cited in: Commun Biol. 2025 Jul 28;8(1):1112. [Abstract]
Cell viability of different groups of cells after adding rMIF (MIF Protein, Human: 100 ng/mL) at different time points.
MIF Protein, Human purchased from MedChemExpress. Usage Cited in: Commun Biol. 2025 Jul 28;8(1):1112. [Abstract]
rMIF (MIF Protein, Human: 100 ng/mL). Representative micrographs of C11 BODIPY immunofluorescence staining in HK-2 cells after MIF upregulation and downregulation.
MIF Protein, Human purchased from MedChemExpress. Usage Cited in: Commun Biol. 2025 Jul 28;8(1):1112. [Abstract]
Western blot results of P-AMPK and GPX4 in HK-2 cells after 6 hours of hypoxia following the addition of rMIF (MIF Protein, Human: 100 ng/mL).
-
Int Immunopharmacol
MIF promotes Th17 cell differentiation in Hashimoto's thyroiditis by binding HVEM and activating NF-κB signaling pathway. [Abstract]2023 Aug:121:110494. PMID: 37331297 -
Inflammation
2025 Dec 23;49(1):15. PMID: 41436686 -
J Cell Mol Med
Laminarin Alleviates Acute Lung Injury Induced by LPS Through Inhibition of M1 Macrophage Polarisation. [Abstract]2025 Mar;29(5):e70440. PMID: 40045157 -
Carcinogenesis
Macrophage migration inhibitory factor as a prognostic biomarker in multiple myeloma: clinical significance and in vitro effects. [Abstract]2025 Apr 3;46(2):bgaf033. PMID: 40628663 -
Int J Womens Health
Single-Cell Transcriptomic Analysis Highlights the Impact of NFKB2-Mediated MIF-CD44 Signaling Axis in Endometrioid Endometrial Cancer. [Abstract]2025 Sep 26:17:3293-3313. PMID: 41040843 -
-
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P14174 (M1-A115)
-
Molecular Construction
-
N-term
-
MIF (M1-A115)
Accession # P14174 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
MIF; L-Dopachrome Isomerase; Prev. GLIF; Glycosylation-Inhibiting Factor; Phenylpyruvate Tautomerase; MMIF; GIF; Epididymis Secretory Sperm Binding Protein; L-Dopachrome Tautomerase; Macrophage Migration Inhibitory Factor; Macrophage Migration Inhibitory Factor (Glycosylation-Inhibiting Factor)
-
AA Sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
-
Predicted Molecular Mass
12.5 kDa
-
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized after extensive dialysis against PBS, pH 7.4.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)