Copy Link Print Information

RSPO1/R-spondin-1 Protein, Human (CHO, His)

18 Cited Publications
Customer Review

Based on 18 publication(s) in Google Scholar

RSPO1/R-spondin-1 is a potent activator of the Wnt/β-catenin signaling pathway and a secretory glycoprotein belonging to the R-spondin family. RSPO1 homotetramers synergize with LRP5/6 via LGR4/5/6 and activate the Wnt/β-catenin pathway by inhibiting DKK1/Kremen-mediated LRP6 endocytosis. RSPO1 promotes β-catenin nuclear translocation, drives HSC activation in liver fibrosis, inhibits adipocyte thermogenic gene expression, and promotes intestinal epithelial proliferation. RSPO1/R-spondin-1 Protein, Human (CHO, His) is a recombinant human RSPO1 protein expressed in CHO cells with a C-6*His tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for RSPO1/R-spondin-1 Protein, Human (CHO, His)
  • Experimental Validation Results for RSPO1/R-spondin-1 Protein, Human (CHO, His)
  • RSPO1/R-spondin-1 Protein, Human (CHO, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

RSPO1/R-spondin-1 is a potent activator of the Wnt/β-catenin signaling pathway and a secretory glycoprotein belonging to the R-spondin family. RSPO1 homotetramers synergize with LRP5/6 via LGR4/5/6 and activate the Wnt/β-catenin pathway by inhibiting DKK1/Kremen-mediated LRP6 endocytosis. RSPO1 promotes β-catenin nuclear translocation, drives HSC activation in liver fibrosis, inhibits adipocyte thermogenic gene expression, and promotes intestinal epithelial proliferation[1][2][3][4]. RSPO1/R-spondin-1 Protein, Human (CHO, His) is a recombinant human RSPO1 protein expressed in CHO cells with a C-6*His tag.

Background

1. Protein characteristics of RSPO1/R-spondin-1
RSPO1/R-spondin-1, belonging to the R-Spondin (RSpo) secretory protein family (including RSPO1-4 members), is a potent activator of the Wnt/-catenin signaling pathway[1]. RSPO1/R-spondin-1 is a disulfide-linked secretory glycoprotein containing an N-terminal signal peptide, two furin-like domains (FR), a thrombin ospondin 1 domain (TSP1) and a C-terminal positively charged region. It binds to heparin sulfate proteoglycans (HSPGs) through electrostatic interactions to anchor the extracellular matrix[1][3].
The activity of R-spondin-1/RSPO1 depends largely on the presence of classical Wnt ligands and LRP6. Although R-spondin-1/RSPO1 does not directly activate LRP6, it can interfere with DKK1 function, regulate the turnover of LRP5 or LRP6 receptors and amplify Wnt-dependent signaling[2]. RSPO1/R-spondin-1 inhibits DKK1/Kremen-mediated LRP6 endocytosis, maintains cell surface LRP6 levels, and activates the Wnt/β-catenin pathway. After binding to LGR4/5/6, it releases the ubiquitination and degradation of Wnt receptors by ZNRF3/RNF43, promotes β-catenin nuclear translocation and TCF/LEF-dependent gene transcription[1][3].

2. Application of RSPO1/R-spondin-1
RSPO1/R-spondin-1 participates in the regulation of liver fibrosis: RSPO1/R-spondin-1 can promote the activation of hepatic stellate cells (HSC), upregulate α-SMA and Collagen-I, and drive fibrosis through the Wnt pathway[4].
RSPO1/R-spondin-1 inhibits fat metabolism: Wild-type RSPO1 enhances Wnt signaling through LGR4, inhibits adipocyte mitochondrial respiration and the expression of thermogenic genes (UCP1, PGC-1α), while the p.R219W mutation destroys HSPG binding, which leads to abnormal release and aggravates obesity[3].
RSPO1/R-spondin-1 promotes intestinal epithelial proliferation: RSPO1 promotes the proliferation of intestinal crypt stem cells through the Wnt pathway and repairs mucosal damage[2].

Verified Bioactivity

1.R-Spondin-1 enhances BMP-2-mediated differentiation of MC3T3-E1 cells. The expected ED50 is 1.182 μg/mL.corresponding to a specific activity is 8.46 ×102 units/mg.
2.Measured by its ability to induce Topflash reporter activity in HEK293T human embryonic kidney cells. The ED50 for this effect is 1-10 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    R-Spondin-1 enhances BMP-2-mediated differentiation of MC3T3-E1 cells. The expected ED50 is 1.182 μg/mL.corresponding to a specific activity is 8.46 ×10^2 units/mg.

Technical Parameters

  • Species Human
  • Source CHO
  • Tag C-6*His
  • Accession

    Q2MKA7-1 (S21-A263)

  • Gene ID
    284654  [NCBI]
  • Molecular Construction
    • N-term
    • RSPO1 (S21-A263)
      Accession # Q2MKA7-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    RSPO1; R-Spondin Homolog (Xenopus Laevis); R-Spondin 1; R-Spondin Homolog; Roof Plate-Specific Spondin-1; CRISTIN3; R-Spondin-1; HRspo1; FLJ40906; RSPO; RSPONDIN

  • AA Sequence

    SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

  • Predicted Molecular Mass

    27.8 kDa

  • Molecular Weight

    Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 4% Mannitol, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.01 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Binnerts ME, et al. R-Spondin1 regulates Wnt signaling by inhibiting internalization of LRP6. Proc Natl Acad Sci U S A. 2007 Sep 11;104(37):14700-5. [Content Brief]

[2]. Zhao J, et al. Tipping the balance: modulating the Wnt pathway for tissue repair. Trends Biotechnol. 2009 Mar;27(3):131-6. [Content Brief]

[3]. Sun Y, et al. Human RSPO1 Mutation Represses Beige Adipocyte Thermogenesis and Contributes to Diet-Induced Adiposity. Adv Sci (Weinh). 2023 Apr;10(12):e2207152. [Content Brief]

[4]. Yin X, et al. RSPOs facilitated HSC activation and promoted hepatic fibrogenesis. Oncotarget. 2016 Sep 27;7(39):63767-63778. [Content Brief]

[5]. Silvano S, et al. RSPO1, a potent inducer of pancreatic β cell neogenesis. Cell Rep Med. 2025 May 20;6(5):102126. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     R-Spondin-1 enhances BMP-2-mediated differentiation of MC3T3-E1 cells. The expected ED50 is 1.182 μg/mL.corresponding to a specific activity is 8.46 ×10^2 units/mg.

  • RSPO1/R-spondin-1 Protein, Human (CHO, His) Product Image
    1/16
  • Experimental Validation Results for RSPO1/R-spondin-1 Protein, Human (CHO, His)
  • Experimental Validation Results for RSPO1/R-spondin-1 Protein, Human (CHO, His)
  • RSPO1/R-spondin-1 Protein, Human (CHO, His) Product Image