Copy Link Print Information

IL-33 Protein, Mouse

14 Cited Publications
Customer Review

Based on 14 publication(s) in Google Scholar

IL-33 Protein, Mouse is a tissue-derived nuclear cytokine from the IL-1 family abundantly expressed in endothelial cells, epithelial cells and fibroblast-like cells, both during homeostasis and inflammation.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-33 Protein, Mouse
  • Experimental Validation Results for IL-33 Protein, Mouse
  • Experimental Validation Results for IL-33 Protein, Mouse
  • Experimental Validation Results for IL-33 Protein, Mouse
  • Experimental Validation Results for IL-33 Protein, Mouse
  • Experimental Validation Results for IL-33 Protein, Mouse
  • Experimental Validation Results for IL-33 Protein, Mouse
  • IL-33 Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-33 Protein, Mouse is a tissue-derived nuclear cytokine from the IL-1 family abundantly expressed in endothelial cells, epithelial cells and fibroblast-like cells, both during homeostasis and inflammation.

Background

Interleukin-33 (IL-33) was originally described as an inducer of type 2 immune responses, activating T helper 2 cells and mast cells. Evidence shows that IL-33 also potently stimulates group 2 innate lymphoid cells, regulatory T cells, TH1 cells, CD8+ T cells and natural killer cells[1]. IL-33 is a crucial immune modulator with pleiotropic activities in type-2, type-1 and regulatory immune responses, and important roles in allergic, fibrotic, infectious, and chronic inflammatory diseases[2].

Verified Bioactivity

1.The ED50 is <0.5 ng/mL as measured by murine D10S cells, corresponding to a specific activity of >2.0 × 106 units/mg.
2.Measured in a cell proliferation assay using CTLL-2 cells. The ED50 for this effect is 0.007306 ng/mL, corresponding to a specific activity is 1.37×108 units/mg.
3.Immobilized Mouse IL-33 at 5 μg/mL (100 μl/well) can bind Mouse ST2-Fc.The ED50 of Mouse ST2-Fc is 0.194 μg/mL.
4.Immobilized Mouse ST2 (V192A, C-Fc) at 5 μg/mL (100 μL/well) can bind Mouse IL-33: Biotinylated by NHS-biotin prior to testing. The EC50 of Mouse IL-33 is 5-13 ng/mL.
5.Measured by its binding ability in a functional ELISA. Immobilized Mouse ST2 at 5 μg/mL (100 μL/well) can bind biotinylated Mouse IL-33, the ED50 for this effect is 18.79 ng/mL.

Results
  • Experimental Validation Results for IL-33 Protein, Mouse
    Measured in a cell proliferation assay using CTLL-2 cells.The ED50 for this effect is 0.007306 ng/mL, corresponding to a specific activity is 1.37×108 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q8BVZ5 (S109-I266)

  • Gene ID
    77125  [NCBI]
  • Molecular Construction
    • N-term
    • IL-33 (S109-I266)
      Accession # Q8BVZ5
    • C-term
  • Protein Length

    Partial

  • Synonyms

    rMuIL-33; Il33

  • AA Sequence

    SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

  • Predicted Molecular Mass

    17.6 kDa

  • Molecular Weight

    Approximately 17-22 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for IL-33 Protein, Mouse
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 1 mM EDTA.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Liew FY, et al. Interleukin-33 in health and disease. Nat Rev Immunol. 2016 Nov;16(11):676-689. [Content Brief]

[2]. Cayrol C, et al. Interleukin-33 (IL-33): A nuclear cytokine from the IL-1 family. Immunol Rev. 2018 Jan;281(1):154-168. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Measured in a cell proliferation assay using CTLL-2 cells.The ED50 for this effect is 0.007306 ng/mL, corresponding to a specific activity is 1.37×108 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using CTLL-2 cells.The ED50 for this effect is 0.007306 ng/mL, corresponding to a specific activity is 1.37×108 units/mg.

  • 1/16

    IL-33 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2025 Aug 5;12(1):46. [Abstract]

    Customer Validation
     The uptake of Aβ1-42 by BV2 cells under different concentrations of IL-33 (0-100 ng/mL, 12 h) intervention.

  • 1/16

    IL-33 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2025 Aug 5;12(1):46. [Abstract]

    Customer Validation
     Representative immunofluorescence staining images of BODIPY+ (green) in BV2 cells after IL-33 (50 ng/mL, 12 h) intervention.

  • 1/16

    IL-33 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2025 Aug 5;12(1):46. [Abstract]

    Customer Validation
     We administered exogenous recombinant IL-33 protein (2 µg per 30 g of body weight) intranasally to mice on days 0, 7, 14, 21, 28, 35, and 42 following rmTBI. Detect the percentage of total entries and spontaneous alternations in the Y-maze test.

  • 1/16

    IL-33 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2025 Aug 5;12(1):46. [Abstract]

    Customer Validation
     We administered exogenous recombinant IL-33 protein (2 µg per 30 g of body weight) intranasally to mice on days 0, 7, 14, 21, 28, 35, and 42 following rmTBI. The average speed, total distance, and time taken by mice during the exploration phase of the Barnes maze were measured.

  • 1/16

    IL-33 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2025 Aug 5;12(1):46. [Abstract]

    Customer Validation
     We administered exogenous recombinant IL-33 protein (2 µg per 30 g of body weight) intranasally to mice on days 0, 7, 14, 21, 28, 35, and 42 following rmTBI. The training and spatial exploration paths of mice in the Barnes maze experiment were examined from day 42 to day 46 after rmTBI.

  • IL-33 Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for IL-33 Protein, Mouse
  • Experimental Validation Results for IL-33 Protein, Mouse
  • Experimental Validation Results for IL-33 Protein, Mouse
  • Experimental Validation Results for IL-33 Protein, Mouse
  • Experimental Validation Results for IL-33 Protein, Mouse
  • Experimental Validation Results for IL-33 Protein, Mouse
  • Experimental Validation Results for IL-33 Protein, Mouse
  • IL-33 Protein, Mouse Product Image

  • IL-33 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2025 Aug 5;12(1):46. [Abstract]

    The uptake of Aβ1-42 by BV2 cells under different concentrations of IL-33 (0-100 ng/mL, 12 h) intervention.

  • IL-33 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2025 Aug 5;12(1):46. [Abstract]

    Representative immunofluorescence staining images of BODIPY+ (green) in BV2 cells after IL-33 (50 ng/mL, 12 h) intervention.

  • IL-33 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2025 Aug 5;12(1):46. [Abstract]

    We administered exogenous recombinant IL-33 protein (2 µg per 30 g of body weight) intranasally to mice on days 0, 7, 14, 21, 28, 35, and 42 following rmTBI. Detect the percentage of total entries and spontaneous alternations in the Y-maze test.

  • IL-33 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2025 Aug 5;12(1):46. [Abstract]

    We administered exogenous recombinant IL-33 protein (2 µg per 30 g of body weight) intranasally to mice on days 0, 7, 14, 21, 28, 35, and 42 following rmTBI. The average speed, total distance, and time taken by mice during the exploration phase of the Barnes maze were measured.

  • IL-33 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2025 Aug 5;12(1):46. [Abstract]

    We administered exogenous recombinant IL-33 protein (2 µg per 30 g of body weight) intranasally to mice on days 0, 7, 14, 21, 28, 35, and 42 following rmTBI. The training and spatial exploration paths of mice in the Barnes maze experiment were examined from day 42 to day 46 after rmTBI.