Copy Link Print Information

IFN-gamma Protein, Rat

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

IFN-gamma Protein, Rat is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IFN-gamma Protein, Rat
  • Experimental Validation Results for IFN-gamma Protein, Rat
  • Experimental Validation Results for IFN-gamma Protein, Rat
  • Experimental Validation Results for IFN-gamma Protein, Rat
  • Experimental Validation Results for IFN-gamma Protein, Rat
  • Experimental Validation Results for IFN-gamma Protein, Rat
  • Experimental Validation Results for IFN-gamma Protein, Rat
  • IFN-gamma Protein, Rat Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IFN-gamma Protein, Rat is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.

Background

Interferon-gamma (IFN-γ) is a cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties. IFN-γ activates cells via a different receptor than IFN-α and IFN-β, which accounts for the different physiological properties of the proteins. Production of IFN-γ is largely restricted to activated CD4+ TH1 T cells, CD8+ T cells, and natural killer cells. One of the most important consequences of IFN-γ secretion is the activation of macrophages. In addition, IFN-γ plays a central role in inflammatory responses by activating endothelial cells, promoting TH1 cell development and cellular immune responses, and up-regulation of major histocompatability complex protein expression on antigen-presenting cells[1].

Verified Bioactivity

1.The ED50 is <0.5 ng/mL as measured by WEHI-279 cells, corresponding to a specific activity of >2 × 106 units/mg.
2.Measured by its binding ability in a functional ELISA. Immobilized rat IFN gamma at 10 μg/mL (100 μL/well) can bind biotinylated rat IFN gamma R1. The ED50 for this effect is 5-40 ng/mL.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag Tag Free
  • Accession

    P01581 (G24-C156)

  • Gene ID
    25712  [NCBI]
  • Molecular Construction
    • N-term
    • IFN-gamma (G24-C156)
      Accession # P01581
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IFNG; IMD69; Interferon Gamma; IFG; IFN-Gamma; IFI; Immune Interferon

  • AA Sequence

    GTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

  • Predicted Molecular Mass

    15.4 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34(10):759-68. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized rat IFN gamma at 10 μg/mL (100 μL/well) can bind biotinylated rat IFN gamma R1. The ED50 for this effect is 35.05 ng/mL.

  • 1/16

    IFN-gamma Protein, Rat purchased from MedChemExpress. Usage Cited in: ACS Appl Mater Interfaces. 2025 Jul 30;17(30):42637-42657. [Abstract]

    Customer Validation
     IFN-gamma (IFN-γ) (30 ng/mL). Western blot analysis showing reduced inflammation in MΦs treated with TSC-sEVs transfected with miRNA mimics of miR-145-3p and miR-504.

  • 1/16

    IFN-gamma Protein, Rat purchased from MedChemExpress. Usage Cited in: ACS Appl Mater Interfaces. 2025 Jul 30;17(30):42637-42657. [Abstract]

    Customer Validation
     Western blot analysis of iNOS, COX-2, and ARG-1 in H-sEV-treated MΦs. In primary rat inflammatory MΦs─M1MΦs induced by LPS+IFN-γ (IFN-gamma) (30 ng/mL), H-TSC-sEVs downregulated COX2 and iNOS expression while upregulating the M2 marker ARG-1, a marker typically associated with the anti-inflammatory phenotype of MΦs.

  • 1/16

    IFN-gamma Protein, Rat purchased from MedChemExpress. Usage Cited in: ACS Appl Mater Interfaces. 2025 Jul 30;17(30):42637-42657. [Abstract]

    Customer Validation
     IFN-gamma (IFN-γ) (30 ng/mL). qRT-PCR analysis of mRNAs related to tendon healing and inflammation in TSCs, MFBs, and MΦs.

  • 1/16

    IFN-gamma Protein, Rat purchased from MedChemExpress. Usage Cited in: Sens Actuators B Chem. 2024 May 1, 406, 135441.

    Customer Validation
     Cells were incubated with 10 μg/mL LPS + 50 ng/mL IFN-γ (IFN-gamma) for 12 h, then incubated with 200 μM UA for 1 h, and finally added 10 μM ER-ONOO-NPs for 3 h. The results showed that stronger fluorescence signals in R28 cells were observed in the LPS and IFN-γ treated group, and the fluorescence intensity was attenuated with the addition of UA as the ONOO− scavenger.

  • 1/16

    IFN-gamma Protein, Rat purchased from MedChemExpress. Usage Cited in: Stem Cell Res Ther. 2022 Jul 15;13(1):295. [Abstract]

    Customer Validation
     Protein levels of M1 markers (iNOS) and M2 markers (Arg1) in LPS+IFNγ (IFN-gamma) (40 ng/mL; 24 h)-stimulated macrophages after incubation with PBS or BMSC-Exos for 48 h.

  • IFN-gamma Protein, Rat Product Image
    1/16
  • Experimental Validation Results for IFN-gamma Protein, Rat
  • Experimental Validation Results for IFN-gamma Protein, Rat
  • Experimental Validation Results for IFN-gamma Protein, Rat
  • Experimental Validation Results for IFN-gamma Protein, Rat
  • Experimental Validation Results for IFN-gamma Protein, Rat
  • Experimental Validation Results for IFN-gamma Protein, Rat
  • Experimental Validation Results for IFN-gamma Protein, Rat
  • IFN-gamma Protein, Rat Product Image

  • IFN-gamma Protein, Rat purchased from MedChemExpress. Usage Cited in: ACS Appl Mater Interfaces. 2025 Jul 30;17(30):42637-42657. [Abstract]

    IFN-gamma (IFN-γ) (30 ng/mL). Western blot analysis showing reduced inflammation in MΦs treated with TSC-sEVs transfected with miRNA mimics of miR-145-3p and miR-504.

  • IFN-gamma Protein, Rat purchased from MedChemExpress. Usage Cited in: ACS Appl Mater Interfaces. 2025 Jul 30;17(30):42637-42657. [Abstract]

    Western blot analysis of iNOS, COX-2, and ARG-1 in H-sEV-treated MΦs. In primary rat inflammatory MΦs─M1MΦs induced by LPS+IFN-γ (IFN-gamma) (30 ng/mL), H-TSC-sEVs downregulated COX2 and iNOS expression while upregulating the M2 marker ARG-1, a marker typically associated with the anti-inflammatory phenotype of MΦs.

  • IFN-gamma Protein, Rat purchased from MedChemExpress. Usage Cited in: ACS Appl Mater Interfaces. 2025 Jul 30;17(30):42637-42657. [Abstract]

    IFN-gamma (IFN-γ) (30 ng/mL). qRT-PCR analysis of mRNAs related to tendon healing and inflammation in TSCs, MFBs, and MΦs.

  • IFN-gamma Protein, Rat purchased from MedChemExpress. Usage Cited in: Sens Actuators B Chem. 2024 May 1, 406, 135441.

    Cells were incubated with 10 μg/mL LPS + 50 ng/mL IFN-γ (IFN-gamma) for 12 h, then incubated with 200 μM UA for 1 h, and finally added 10 μM ER-ONOO-NPs for 3 h. The results showed that stronger fluorescence signals in R28 cells were observed in the LPS and IFN-γ treated group, and the fluorescence intensity was attenuated with the addition of UA as the ONOO− scavenger.

  • IFN-gamma Protein, Rat purchased from MedChemExpress. Usage Cited in: Stem Cell Res Ther. 2022 Jul 15;13(1):295. [Abstract]

    Protein levels of M1 markers (iNOS) and M2 markers (Arg1) in LPS+IFNγ (IFN-gamma) (40 ng/mL; 24 h)-stimulated macrophages after incubation with PBS or BMSC-Exos for 48 h.