Chlorotoxin(linear)
Chlorotoxin(linear) is a linear 36 amino-acid peptide which can be used in Chlorotoxin related research.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Fòrmula: C158H256N52O48S11
- Peso molecular:4004.76
-
Almacenamiento:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Chemical Information
- Pureza y Documentación
-
Help & FAQs
Actividad biológica
Chemical Information
-
Appearance Solid
-
Peso molecular 4004.76
-
Fòrmula C158H256N52O48S11
-
Color White to light yellow
-
Sequence
Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Lys-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Lys-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-NH2
-
Sequence Shortening
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Pureza y Documentación
-
Ficha de datos (232 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instrucciones de manejo (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Chlorotoxin(linear) Related Classifications
HY-P0173 Related Classifications
Powered by Bioz