Super-TDU
Based on 6 publication(s) in Google Scholar
Super-TDU is a specific YAP antagonist targeting YAP-TEADs interaction. Super-TDU suppresses tumor growth in gastric cancer mouse model.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Pureza: 99.18%
- No. CAS: 1599441-71-0
- Fòrmula: C237H369N65O70S
- Peso molecular:5280.92
-
Almacenamiento:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications Citing Use of MedChemExpress (MCE) Super-TDU
MoreVer todos los productos específicos de isoformas YAP
More
Actividad biológica
Descripciòn
IC50 & Target
|
YAP/TAZ-TEAD |
In Vitro
Super-TDU downregulates expression of YAP-TEADs target genes CTGF, CYR61, and CDX2. Super-TDU inhibits cell viability and colony formation of GC cell lines MGC-803, BGC-823, and HGC27[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
Super-TDU (intravenous injection; 250 μg/kg 500 μg/kg) has the t1/2α of 0.78 hours and 0.82 hours; the Cmax of 6.12 ng/mL and 13.3 ng/mL; the CL of 7.41 ml/min/kg and 7.72 ml/min/kg for 250 μg/kg and 500 μg/kg in mice, respectively[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:BALB/cA nu/nu mice[1]
-
Dosage:50 μg/kg or 500 μg/kg
-
Administration:Intravenous Injection; per day
-
Result:Decreased the sizes, weights of tumors, and YAP target genes in a dose-dependent manner.
-
Animal Model:BALB/cA nu/nu mice[1]
-
Dosage:250 μg/kg or 500 μg/kg (Pharmacokinetic Study)
-
Administration:Intravenous Injection
-
Result:The t1/2α is 0.78 hours and 0.82 hours; the Cmax is 6.12 ng/mL and 13.3 ng/mL; the CL is7.41 ml/min/kg and 7.72 ml/min/kg for 250 μg/kg and 500 μg/kg in mice, respectively.
Chemical Information
-
No. CAS 1599441-71-0
-
Appearance Solid
-
Peso molecular 5280.92
-
Fòrmula C237H369N65O70S
-
Color White to off-white
-
Sequence
Ser-Val-Asp-Asp-His-Phe-Ala-Lys-Ser-Leu-Gly-Asp-Thr-Trp-Leu-Gln-Ile-Gly-Gly-Ser-Gly-Asn-Pro-Lys-Thr-Ala-Asn-Val-Pro-Gln-Thr-Val-Pro-Met-Arg-Leu-Arg-Lys-Leu-Pro-Asp-Ser-Phe-Phe-Lys-Pro-Pro-Glu
-
Sequence Shortening
SVDDHFAKSLGDTWLQIGGSGNPKTANVPQTVPMRLRKLPDSFFKPPE
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (6)
-
Journal Impact Factor
-
Most Recent
-
Cancer Lett
SGLT2 promotes pancreatic cancer progression by activating the Hippo signaling pathway via the hnRNPK-YAP1 axis. [Abstract]2021 Oct 28:519:277-288. PMID: 34314754 -
Int Immunopharmacol
Methionine restriction inhibits the TGF-β1/CCN2/NF-κB pathway to attenuate astrocyte inflammation and cognitive impairment in the APP/PS1 mice. [Abstract]2025 Sep 15:166:115498. PMID: 40957174 -
Cell Signal
2025 Oct:134:111938. PMID: 40513845 -
Exp Dermatol
Targeting the Hippo/YAP/TAZ signalling pathway: Novel opportunities for therapeutic interventions into skin cancers. [Abstract]2022 Oct;31(10):1477-1499. PMID: 35913427 -
Discov Oncol
Targeting XPO6 inhibits prostate cancer progression and enhances the suppressive efficacy of docetaxel. [Abstract]2023 May 27;14(1):82. PMID: 37243787 -
Biol Pharm Bull
2024;47(1):166-174. PMID: 38220212
Solvente y solubilidad
In Vitro:
DMSO : 100 mg/mL (18.94 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : 50 mg/mL (9.47 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
In Vivo:
For the following dissolution methods, please prepare the working solution directly:
It is recommended to prepare fresh solutions and use them promptly within a short period of time.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.
Add each solvent one by one: PBS
Solubility: 25 mg/mL (4.73 mM); Clear solution; Need ultrasonic
Pureza y Documentación
-
Ficha de datos (292 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instrucciones de manejo (2659 KB)
Referencias
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O / DMSO | 1 mM | 0.1894 mL | 0.9468 mL | 1.8936 mL | 4.7340 mL |
| 5 mM | 0.0379 mL | 0.1894 mL | 0.3787 mL | 0.9468 mL | |
| DMSO | 10 mM | 0.0189 mL | 0.0947 mL | 0.1894 mL | 0.4734 mL |
| 15 mM | 0.0126 mL | 0.0631 mL | 0.1262 mL | 0.3156 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.