Insulin (swine)
Based on 1 Customer Validation
Insulin (swine) is an orally active insulin derived from pigs. Insulin (swine) when administered orally acts as an antigen to reduce the severity of pancreatic lymphocyte infiltration, but has no metabolic effect on blood glucose levels. Insulin (swine) increases glucose oxidation, stimulates lipogenesis, and lowers blood glucose levels. Insulin (swine) can be used in diabetes research.
For research use only. We do not sell to patients.
- Purity : 99.90%
- CAS No.: 12584-58-6
- Formula: C256H381N65O76S6
- Molecular Weight:5777.54
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Description
In Vitro
Insulin swine (2 h) causes a concentration-dependent increase in glucose oxidation in swine adipose tissue[1].
Insulin swine (1-1000 ng/mL; 2 h) significantly stimulates lipogenesis in the adipose tissue of80-kg pigs, but does not affect glycerol release[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
Insulin swine (0.16 U/kg; i.v.) reduces blood glucose levels in diabetic Lewis rats[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Nonobese diabetic mice[2]
-
Dosage:1 mg
-
Administration:Oral gavage (p.o.); twice a week for 5 weeks and then weekly until 1 year of age
-
Result:Had no metabolic effect on blood glucose levels.
Reduced the severity of lymphocytic infiltration of pancreatic islets.
Generated active cellular mechanisms that suppress disease.
Affected diabetes and the pancreatic cellular inflammatory process.
Chemical Information
-
CAS No. 12584-58-6
-
Appearance Solid
-
Molecular Weight 5777.54
-
Formula C256H381N65O76S6
-
Color White to off-white
-
Sequence
Chain 1:Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Ala Chain 2:Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn (Disulfide bridge:1'Cys7-2'Cys7,1'Cys19-2'Cys20,1'Cys6-2'Cys11)
-
Sequence Shortening
Chain 1:FVNQHLCGSHLVEALYLVCGERGFFYTPKA Chain 2:GIVEQCCTSICSLYQLENYCN (Disulfide bridge:1'Cys7-2'Cys7,1'Cys19-2'Cys20,1'Cys6-2'Cys11)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
H2O : 20 mg/mL (3.46 mM; ultrasonic and adjust pH to 3 with HCl)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (274 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Walton PE, et al. Stimulation of lipogenesis by insulin in swine adipose tissue: antagonism by porcine growth hormone. J Anim Sci. 1986 Jun;62(6):1584-95. [Content Brief]
[2]. Z J Zhang, et al. Suppression of diabetes in nonobese diabetic mice by oral administration of porcine insulin. Proc Natl Acad Sci U S A. 1991 Nov 15;88(22):10252-6. [Content Brief]
[3]. Pepper AR, et al. Diabetic rats and mice are resistant to porcine and human insulin: flawed experimental models for testing islet xenografts. Xenotransplantation. 2009 Nov-Dec;16(6):502-10. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.1731 mL | 0.8654 mL | 1.7308 mL | 4.3271 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.