Insulin (swine)
Based on 1 Customer Validation
Insulin (swine) is an orally active insulin derived from pigs. Insulin (swine) when administered orally acts as an antigen to reduce the severity of pancreatic lymphocyte infiltration, but has no metabolic effect on blood glucose levels. Insulin (swine) increases glucose oxidation, stimulates lipogenesis, and lowers blood glucose levels. Insulin (swine) can be used in diabetes research.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit : 99.90%
- CAS. Nr.: 12584-58-6
- Formel: C256H381N65O76S6
- Molecular Weight:5777.54
-
Speicherung:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biologische Aktivität
-
Chemical Information
-
Lösungsmittel & Löslichkeit
- Protokoll
- Reinheit & Dokumentation
- Verweise
-
Help & FAQs
-
HY-P1156
Insulin(cattle)Recombinant Cattle Insulin -
HY-14648
DexamethasoneGR Agonist -
HY-12318
IBMXPDE Inhibitor -
HY-P0035
Insulin (human)Recombinant Human Insulin -
HY-P0035A
Insulin solution (human)Polypeptide Hormone -
HY-15531
VenetoclaxBCL-2 Inhibitor -
HY-15575
VcMMAEDrug-Linker Conjugate for ADC -
HY-17031
SBE-β-CDExcipient -
HY-10108
LY294002PI3K Inhibitor -
HY-112906
C-176STING Inhibitor -
HY-17386
RosiglitazonePPARγ Agonist -
HY-116215
2-NBDGFluorescent Indicator
Biologische Aktivität
Beschreibung
In Vitro
Insulin swine (2 h) causes a concentration-dependent increase in glucose oxidation in swine adipose tissue[1].
Insulin swine (1-1000 ng/mL; 2 h) significantly stimulates lipogenesis in the adipose tissue of80-kg pigs, but does not affect glycerol release[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
Insulin swine (0.16 U/kg; i.v.) reduces blood glucose levels in diabetic Lewis rats[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Nonobese diabetic mice[2]
-
Dosage:1 mg
-
Administration:Oral gavage (p.o.); twice a week for 5 weeks and then weekly until 1 year of age
-
Result:Had no metabolic effect on blood glucose levels.
Reduced the severity of lymphocytic infiltration of pancreatic islets.
Generated active cellular mechanisms that suppress disease.
Affected diabetes and the pancreatic cellular inflammatory process.
Chemical Information
-
CAS. Nr. 12584-58-6
-
Appearance Solid
-
Molecular Weight 5777.54
-
Formel C256H381N65O76S6
-
Color White to off-white
-
Sequence
Chain 1:Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Ala Chain 2:Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn (Disulfide bridge:1'Cys7-2'Cys7,1'Cys19-2'Cys20,1'Cys6-2'Cys11)
-
Sequence Shortening
Chain 1:FVNQHLCGSHLVEALYLVCGERGFFYTPKA Chain 2:GIVEQCCTSICSLYQLENYCN (Disulfide bridge:1'Cys7-2'Cys7,1'Cys19-2'Cys20,1'Cys6-2'Cys11)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Lösungsmittel & Löslichkeit
In Vitro:
H2O : 20 mg/mL (3.46 mM; ultrasonic and adjust pH to 3 with HCl)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Reinheit & Dokumentation
-
Data Sheet (274 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
[1]. Walton PE, et al. Stimulation of lipogenesis by insulin in swine adipose tissue: antagonism by porcine growth hormone. J Anim Sci. 1986 Jun;62(6):1584-95. [Content Brief]
[2]. Z J Zhang, et al. Suppression of diabetes in nonobese diabetic mice by oral administration of porcine insulin. Proc Natl Acad Sci U S A. 1991 Nov 15;88(22):10252-6. [Content Brief]
[3]. Pepper AR, et al. Diabetic rats and mice are resistant to porcine and human insulin: flawed experimental models for testing islet xenografts. Xenotransplantation. 2009 Nov-Dec;16(6):502-10. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.1731 mL | 0.8654 mL | 1.7308 mL | 4.3271 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Insulin (swine) Related Classifications
HY-P3479 Related Classifications
Powered by Bioz