country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P3627

Copy Link Print Information

Nagrestipen

Nagrestipen, a human macrophage inflammatory protein-1 alpha (MIP-1α) variant, also known as ECI 301. Nagrestipen has antitumor activity and can be used in therapeutic trials to study cancer, tumors, metastases, radiation oncology, and tumor metastasis.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

CAS No.: 166089-33-4
화학식: C₃₃₈H₅₁₆N₈₈O₁₀₈S₄
분자량:7668.48

보관:

Please store the product under the recommended conditions in the Certificate of Analysis.

Nagrestipen Chemical Structure

CAS No.: 166089-33-4

사이즈

가격

재고

수량

Amount: USD 0.00

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

제품 설명

In Vivo

Nagrestipen (ECI 301) (i.v; 2 μg; daily for 5 days) significantly inhibits tumor growth at 6 Gy local irradiation of tumor sites and enhances the distant septal effect of radiation in male BALB/c mice^[1].
Nagrestipen (ECI 301) (i.v; 0.08, 0.4, 2 μg; day 1,8,15) can inhibit tumor growth in a dose-dependent manner at both irradiated and unirradiated sites of female C57BL/6 with LLC cells^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:

Male BALB/c mice with Colon26 cells and MethA cells^[1]
Dosage:

2 μg
Administration:

Intravenous injection; daily for 5 days
Result:

Significantly inhibited tumor size without significant toxicity.
Stopped tumor growth in the colon not only at the irradiated site but also at the unirradiated.

Chemical Information

CAS No. 166089-33-4
분자량 7668.48
화학식 C₃₃₈H₅₁₆N₈₈O₁₀₈S₄
Sequence Shortening

SLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA (Disulfide bridge:Cys10-Cys34;Cys11-Cys50)
선적

Room temperature in continental US; may vary elsewhere.
보관

Please store the product under the recommended conditions in the Certificate of Analysis.

순도&문서

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (261 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Kenshiro Shiraishi, et al. Enhancement of antitumor radiation efficacy and consistent induction of the abscopal effect in mice by ECI301, an active variant of macrophage inflammatory protein-1alpha. Clin Cancer Res. 2008 Feb 15;14(4):1159-66. [Content Brief]

Calculators

몰농도 계산기

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

농도 희석 계산기

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

MOQ

Minimum order quantity

100 mg

견적 받기 해외재고보유

Other size

견적 받기