Super-TDU TFA
Based on 6 publication(s) in Google Scholar
Super-TDU TFA is a specific YAP antagonist targeting YAP-TEADs interaction. Super-TDU TFA suppresses tumor growth in gastric cancer mouse model.
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- 화학식: C237H369N65O70S·xC2HF3O2
- 분자량:5280.92 (free acid)
-
보관:
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications Citing Use of MedChemExpress (MCE) Super-TDU TFA
MoreAll YAP Isoforms
More
Biological Activity
|
YAP/TAZ-TEAD |
Super-TDU TFA downregulates expression of YAP-TEADs target genes CTGF, CYR61, and CDX2. Super-TDU TFA inhibits cell viability and colony formation of GC cell lines MGC-803, BGC-823, and HGC27[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Super-TDU TFA (Intravenous Injection; 250 μg/kg 500 μg/kg) has the t1/2α of 0.78 hours and 0.82 hours; the Cmax of 6.12 ng/mL and 13.3 ng/mL; the CL of 7.41 ml/min/kg and 7.72 ml/min/kg for 250 μg/kg and 500 μg/kg in mice, respectively[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:BALB/cA nu/nu mice[1]
-
Dosage:50 μg/kg or 500 μg/kg
-
Administration:Intravenous Injection; per day
-
Result:Decreased the sizes, weights of tumors, and YAP target genes in a dose-dependent manner.
-
Animal Model:BALB/cA nu/nu mice[1]
-
Dosage:250 μg/kg or 500 μg/kg (Pharmacokinetic Study)
-
Administration:Intravenous Injection
-
Result:The t1/2α is 0.78 hours and 0.82 hours; the Cmax is 6.12 ng/mL and 13.3 ng/mL; the CL is7.41 ml/min/kg and 7.72 ml/min/kg for 250 μg/kg and 500 μg/kg in mice, respectively.
Chemical Information
-
분자량 5280.92 (free acid)
-
화학식 C237H369N65O70S·xC2HF3O2
-
Sequence
Ser-Val-Asp-Asp-His-Phe-Ala-Lys-Ser-Leu-Gly-Asp-Thr-Trp-Leu-Gln-Ile-Gly-Gly-Ser-Gly-Asn-Pro-Lys-Thr-Ala-Asn-Val-Pro-Gln-Thr-Val-Pro-Met-Arg-Leu-Arg-Lys-Leu-Pro-Asp-Ser-Phe-Phe-Lys-Pro-Pro-Glu
-
Sequence Shortening
SVDDHFAKSLGDTWLQIGGSGNPKTANVPQTVPMRLRKLPDSFFKPPE
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications (6)
-
Journal Impact Factor
-
Most Recent
-
Cancer Lett
SGLT2 promotes pancreatic cancer progression by activating the Hippo signaling pathway via the hnRNPK-YAP1 axis. [Abstract]2021 Oct 28:519:277-288. PMID: 34314754 -
Int Immunopharmacol
Methionine restriction inhibits the TGF-β1/CCN2/NF-κB pathway to attenuate astrocyte inflammation and cognitive impairment in the APP/PS1 mice. [Abstract]2025 Sep 15:166:115498. PMID: 40957174 -
Cell Signal
2025 Jun 11:111938. PMID: 40513845 -
Exp Dermatol
Targeting the Hippo/YAP/TAZ signalling pathway: Novel opportunities for therapeutic interventions into skin cancers. [Abstract]2022 Oct;31(10):1477-1499. PMID: 35913427 -
Discov Oncol
Targeting XPO6 inhibits prostate cancer progression and enhances the suppressive efficacy of docetaxel. [Abstract]2023 May 27;14(1):82. PMID: 37243787 -
Biol Pharm Bull
2024;47(1):166-174. PMID: 38220212
순도&문서
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)