1. GPCR/G Protein Anti-infection
  2. Formyl Peptide Receptor (FPR) Bacterial
  3. LL-37 amide TFA

LL-37 amide TFA is a selective agonist of formyl peptide receptor-like FPRL1, effectively inhibiting periodontal pathogens (ED99=8.5-8.7 μg/mL). LL-37 amide TFA exerts its bactericidal effect by activating FPRL1-mediated immune cell chemotaxis and disrupting bacterial cell membrane integrity. It can also regulate inflammatory responses (inhibiting the release of factors such as TNF-α) and promote angiogenesis. Amidation modification reduces its sensitivity to serum inhibition and improves its stability. LL-37 amide TFA possesses key activities in bactericidal action, immunomodulation, and wound healing, and is mainly used in research on infection-related diseases such as periodontal disease and deep tissue injuries (pressure ulcers), and wound healing.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

LL-37 amide TFA

LL-37 amide TFA Chemical Structure

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 2 publication(s) in Google Scholar

Other Forms of LL-37 amide TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

LL-37 amide TFA is a selective agonist of formyl peptide receptor-like FPRL1, effectively inhibiting periodontal pathogens (ED99=8.5-8.7 μg/mL). LL-37 amide TFA exerts its bactericidal effect by activating FPRL1-mediated immune cell chemotaxis and disrupting bacterial cell membrane integrity. It can also regulate inflammatory responses (inhibiting the release of factors such as TNF-α) and promote angiogenesis. Amidation modification reduces its sensitivity to serum inhibition and improves its stability. LL-37 amide TFA possesses key activities in bactericidal action, immunomodulation, and wound healing, and is mainly used in research on infection-related diseases such as periodontal disease and deep tissue injuries (pressure ulcers), and wound healing[1][2][3][4].

In Vitro

LL-37 amide TFA is the carboxyl-terminal amidated form of LL-37. Compared to natural LL-37, it exhibits significantly improved stability and enhanced resistance to enzymatic degradation[1].
Antibacterial activity: It shows good antibacterial effects against both Gram-positive bacteria (such as *Bacillus megaterium*) and Gram-negative bacteria (such as *Escherichia coli* D21). The MIC against D21 is approximately 5 μM, comparable to that of natural LL-37[1].
Cytotoxicity: The toxicity to eukaryotic cells is concentration-dependent, with a safe concentration range of 0.1-10 μM. Toxicity increases significantly at concentrations above 10 μM[1].
LL-37 amide TFA (8.5-8.7 μg/mL; 1 h) exhibits bactericidal activity against *Actinobacillus actinomycetemcomitans* FDC-Y4 and *Porphyromonas gingivalis* ATCC 33123, with ED99 values ??of 8.7 μg/mL and 8.5 μg/mL, respectively[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

In vivo experiments often use natural LL-37 (free carboxyl form) rather than LL-37 amide TFA. It is recommended to select models related to the in vitro activity of LL-37 amide TFA, such as skin infection models, wound healing models, and inflammation models, as directions for further research. For example, in a Staphylococcus aureus skin infection model in BALB/c mice, 10 μg of LL-37 amide TFA was applied topically (in combination with a chitosan hydrogel). The results showed that the LL-37 amide TFA-chitosan hydrogel significantly accelerated wound healing, improved bacterial clearance, and reduced inflammatory responses, with better results than free LL-37[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4492.28 (free base)

Formula

C205H341N61O52.xC2HF3O2

Appearance

Solid

Color

White to off-white

Sequence

Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2

Sequence Shortening

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

DMSO : 50 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation

Purity: 99.97%

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LL-37 amide TFA
Cat. No.:
HY-P4744A
Quantity:
MCE Japan Authorized Agent: