Martentoxin
Martentoxin, a 4,046 Da polypeptide toxin, is a large-conductance Ca2+-activated K+ (BKCa) channel inhibitor. Martentoxin attenuates NO release, inhibits iNOS activation and upregulates eNOS mRNA expression in HUVECs induced by TNF-α. Martentoxin can be used for vascular diseases research.
For research use only. We do not sell to patients.
- Formula: C171H262N50O53S6
- Molecular Weight:4058.60
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Description
IC50 & Target
[1]|
iNOS |
eNOS |
Chemical Information
-
Molecular Weight 4058.60
-
Formula C171H262N50O53S6
-
Sequence
Phe-Gly-Leu-Ile-Asp-Val-Lys-Cys-Phe-Ala-Ser-Ser-Glu-Cys-Trp-Thr-Ala-Cys-Lys-Lys-Val-Thr-Gly-Ser-Gly-Gln-Gly-Lys-Cys-Gln-Asn-Asn-Gln-Cys-Arg-Cys-Tyr (disulfide bridge:Cys8-Cys29,Cys14-Cys34,Cys18-Cys36)
-
Sequence Shortening
FGLIDVKCFASSECWTACKKVTGSGQGKCQNNQCRCY (disulfide bridge:Cys8-Cys29,Cys14-Cys34,Cys18-Cys36)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocols
-
RT-PCR
Reverse transcription technology uses RNA as a template to synthesize DNA. RT-PCR is simple, specific and sensitive, and can be used to detect gene expression levels and expression differences in cells; detect RNA virus content; clone cDNA sequences of specific genes.
-
RNA extraction experimental
By lysing cells, releasing RNA, and removing impurities such as proteins and DNA, high-purity RNA products are finally obtained. The commonly used traditional method is the guanidine isothiocyanate/phenol/chloroform method (Trizol), which is suitable for a variety of animal materials including animal tissues, microorganisms, cultured cells, etc., and most plant materials.
-
Ca2+ Staining Technique
Ca2+ staining is an experimental technique that utilizes specific fluorescent probes (such as Fluo-4 AM, Fura-2, etc.) to qualitatively or quantitatively detect dynamic changes in intracellular Ca2+ concentrations; this is achieved by monitoring the changes in fluorescent signals generated when these probes bind to free intracellular calcium ions. The underlying principle relies primarily on the presence of chelating groups within the probe's molecular structure that possess high affinity for calcium ions.
-
Real Time qPCR (Q-PCR)
Real-time quantitative PCR (qPCR) quantifies an amplifiable nucleic-acid target by monitoring fluorescence during PCR cycling rather than measuring product only after amplification. The increase in fluorescence tracks accumulation of PCR product, and the quantification cycle (Cq; historically also Ct/CP) is related to the initial amount of target: samples containing more starting target generally reach the defined fluorescence threshold in fewer cycles.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)