Nagrestipen
Nagrestipen, a human macrophage inflammatory protein-1 alpha (MIP-1α) variant, also known as ECI 301. Nagrestipen has antitumor activity and can be used in therapeutic trials to study cancer, tumors, metastases, radiation oncology, and tumor metastasis.
For research use only. We do not sell to patients.
- CAS No.: 166089-33-4
- Formula: C338H516N88O108S4
- Molecular Weight:7668.48
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Description
In Vivo
Nagrestipen (ECI 301) (i.v; 0.08, 0.4, 2 μg; day 1,8,15) can inhibit tumor growth in a dose-dependent manner at both irradiated and unirradiated sites of female C57BL/6 with LLC cells[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Male BALB/c mice with Colon26 cells and MethA cells[1]
-
Dosage:2 μg
-
Administration:Intravenous injection; daily for 5 days
-
Result:Significantly inhibited tumor size without significant toxicity.
Stopped tumor growth in the colon not only at the irradiated site but also at the unirradiated.
Chemical Information
-
CAS No. 166089-33-4
-
Molecular Weight 7668.48
-
Formula C338H516N88O108S4
-
Sequence Shortening
SLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA (Disulfide bridge:Cys10-Cys34;Cys11-Cys50)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)