PAP 248-286 acetate
Based on 1 Customer Validation
PAP 248-286 (Prostatic acid phosphatase (248-286)) acetate is a biological active peptide. PAP (248-286) acetate is a semen-derived enhancer of viral infection (SEVI) factor found in semen. This peptide greatly increases HIV infection through enhanced virion attachment to target cells..
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Formule: C203H342N60O54S2.xC2H4O2
- Masse moléculaire:4551.39 (free acid)
-
Stockage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
-
Solvant et solubilité
- Protocole
- Pureté et documentation
- Références
-
Help & FAQs
Activité biologique
Description
Chemical Information
-
Appearance Solid
-
Masse moléculaire 4551.39 (free acid)
-
Formule C203H342N60O54S2.xC2H4O2
-
Synonyms
Prostatic acid phosphatase (248-286) acetate
-
Sequence
Gly-Ile-His-Lys-Gln-Lys-Glu-Lys-Ser-Arg-Leu-Gln-Gly-Gly-Val-Leu-Val-Asn-Glu-Ile-Leu-Asn-His-Met-Lys-Arg-Ala-Thr-Gln-Ile-Pro-Ser-Tyr-Lys-Lys-Leu-Ile-Met-Tyr
-
Sequence Shortening
GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvant et solubilité
In Vitro:
DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Protocole
-
Research Protocol for Infectious Diseases
Infectious-disease experiments test how pathogens interact with host barriers, innate immune receptors, inflammatory signaling, pathogen replication, and tissue injury; pattern-recognition receptors such as TLRs, RIG-I-like receptors, NOD-like receptors, and inflammasomes detect microbial molecules and activate NF-κB, interferon, and cytokine responses. The central hypothesis is that infection severity reflects the balance between pathogen burden and host response: protective inflammation restricts pathogen growth, whereas excessive or mislocalized inflammation contributes to tissue damage and disease phenotype. Unresolved questions include which host pathways are protective versus pathogenic, why some infection models fail to translate to human disease, and which combined readouts best predict clinically relevant infection outcomes.
Pureté et documentation
-
Fiche technique (281 KB)
-
SDS (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instruction de manipulation (2659 KB)
Références
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
PAP 248-286 acetate Related Classifications
HY-P5363A Related Classifications
Powered by Bioz