country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P5363A

Copy Link Print Information

PAP 248-286 acetate

(Synonyms: Prostatic acid phosphatase (248-286) acetate)

Customer Review

Based on 1 Customer Validation

PAP 248-286 (Prostatic acid phosphatase (248-286)) acetate is a biological active peptide. PAP (248-286) acetate is a semen-derived enhancer of viral infection (SEVI) factor found in semen. This peptide greatly increases HIV infection through enhanced virion attachment to target cells..

For research use only. We do not sell to patients.

Formula: C₂₀₃H₃₄₂N₆₀O₅₄S₂.xC₂H₄O₂
Molecular Weight:4551.39 (free acid)

Storage:

Sealed storage, away from moisture.

Powder -80°C, 2 years , -20°C, 1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

PAP 248-286 acetate Chemical Structure

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

All HIV Isoforms :

Chemical Information

Appearance Solid
Molecular Weight 4551.39 (free acid)
Formula C₂₀₃H₃₄₂N₆₀O₅₄S₂.xC₂H₄O₂
Synonyms

Prostatic acid phosphatase (248-286) acetate
Sequence

Gly-Ile-His-Lys-Gln-Lys-Glu-Lys-Ser-Arg-Leu-Gln-Gly-Gly-Val-Leu-Val-Asn-Glu-Ile-Leu-Asn-His-Met-Lys-Arg-Ala-Thr-Gln-Ile-Pro-Ser-Tyr-Lys-Lys-Leu-Ile-Met-Tyr
Sequence Shortening

GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility

In Vitro:

DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

View the Complete Stock Solution Preparation Table

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (281 KB)
SDS (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Popovych N, et al. Site specific interaction of the polyphenol EGCG with the SEVI amyloid precursor peptide PAP(248-286). J Phys Chem B. 2012 Mar 22;116(11):3650-8. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Get Quote In-stock

Amount: USD 0.00

Biological Activity
- Description
Chemical Information
Solvent & Solubility
- In Vitro
Purity & Documentation
References

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent:

Product Name:
CAS No.:
Species:
Purity:
Quantity:

PAP 248-286 acetate

Peptide Library

All HIV Isoforms