PINT-87aa TFA

Cat. No.: HY-P3103A: FAQs
Data Sheet SDS COA Handling Instructions

Molarity Calculator

PINT-87aa TFA, an 87-amino acid (aa) peptide, is encoded by the circular form of the long intergenic non-protein-coding RNA p53-induced transcript (LINC-PINT). PINT-87aa TFA directly interacts with polymerase associated factor complex (PAF1c) and inhibits the transcriptional elongation of multiple oncogenes. PINT-87aa TFA suppresses glioblastoma cell proliferation in vitro and in vivo.

For research use only. We do not sell to patients.

PINT-87aa TFA Chemical Structure

Size		Stock
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of PINT-87aa TFA:

PINT-87aa Get quote

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

In Vitro

Both 456 and 4121 cells overexpressing PINT-87aa exhibits G1 arrest and reduces cell proliferation without obvious cellular toxicity, whereas PINT-87aa K.O. SW1783 and Hs683 cells shows increased cell cycle and cell proliferation rates^[1].
The mRNA of PAF1 downstream genes (CPEB1, SOX-2, c-Myc, etc.) is inhibited transcriptionally in PIN87aa-overexpressing 456 and 4121 cells compared with that in control cells^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

456 and 4121 cells stably overexpressing PINT-87aa exhibits decreased in situ tumorigenic potential compared with control cells, as assessed by tumor growth and animal survival in mice^[1].
PINT-87aa K.O. cells results in significantly increased xenograft tumor volumes of nude mice^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

9721.05

Formula

C₃₉₆H₆₂8N₁₄₀O_{1₁₅S₁₃.C₂HF₃O₂}

Appearance

Solid

Color

White to off-white

Sequence

Met-Leu-Trp-Leu-Pro-Asp-Arg-Gly-Ser-Cys-Ser-Ala-Arg-Ser-Pro-Ser-Gly-Met-Leu-Arg-Gly-Ala-Pro-Gly-Gly-Trp-Arg-Tyr-Gly-Arg-Arg-Cys-Gly-Arg-Arg-Arg-Gln-Ser-Cys-Cys-Cys-Cys-Cys-Cys-Cys-Ser-His-Val-Gly-Ala-Pro-Leu-Ser-Phe-His-Arg-Glu-Ala-Ser-Leu-Val-Ser-His-Asp-Gly-His-Asp-Ile-Met-Lys-Gln-His-Cys-Gly-Glu-Glu-Ser-Ile-Arg-Gly-Ala-His-Gly-Tyr-Lys-Asn-Lys

Sequence Shortening

MLWLPDRGSCSARSPSGMLRGAPGGWRYGRRCGRRRQSCCCCCCCSHVGAPLSFHREASLVSHDGHDIMKQHCGEESIRGAHGYKNK

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility

In Vitro:

H₂O

Peptide Solubility and Storage Guidelines:

1. Calculate the length of the peptide.

2. Calculate the overall charge of the entire peptide according to the following table:

	Contents	Assign value
Acidic amino acid	Asp (D), Glu (E), and the C-terminal -COOH.	-1
Basic amino acid	Arg (R), Lys (K), His (H), and the N-terminal -NH₂	+1
Neutral amino acid	Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q)	0

3. Recommended solution:

Overall charge of peptide	Details
Negative (<0)	1. Try to dissolve the peptide in water first. 2. If water fails, add NH₄OH (<50 μL). 3. If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0)	1. Try to dissolve the peptide in water first. 2. If water fails, try dissolving the peptide in a 10%-30% acetic acid solution. 3. If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0)	1. Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first. 2. For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.

Purity & Documentation

Purity: ≥99.0%

Select Batch:

Data Sheet (264 KB) SDS (252 KB)

COA (247 KB) RP-HPLC (166 KB)

Handling Instructions (2659 KB)

References

[1]. Zhang M, et, al. A peptide encoded by circular form of LINC-PINT suppresses oncogenic transcriptional elongation in glioblastoma. Nat Commun. 2018 Oct 26;9(1):4475. [Content Brief]

PINT-87aa TFA Related Classifications

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

PINT-87aaDNA/RNA SynthesispolymeraseassociatedfactorcomplexPAF1ctranscriptionalelongationoncogenesglioblastomaInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks