Plantaricin F
Plantaricin F is an antibacterial peptide. Plantaricin F strongly inhibits several gram-negative bacteria including the foodbome pathogens Salmonella enteritidis and Pseudomonas aeruginosa. Plantaricin F inhibits several Lactobacillus, Pediococcus and Leuconostoc species.
For research use only. We do not sell to patients.
- CAS No.: 159605-63-7
- Formula: C169H253N51O44
- Molecular Weight:3703.13
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Chemical Information
-
CAS No. 159605-63-7
-
Molecular Weight 3703.13
-
Formula C169H253N51O44
-
Sequence
Val-Phe-His-Ala-Tyr-Ser-Ala-Arg-Gly-Val-Arg-Asn-Asn-Tyr-Lys-Ser-Ala-Val-Gly-Pro-Ala-Asp-Trp-Val-Ile-Ser-Ala-Val-Arg-Gly-Phe-Ile-His-Gly
-
Sequence Shortening
VFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Fricourt BV, Barefoot SF, Testin RF, Hayasaka SS. Detection and Activity of Plantaricin F an Antibacterial Substance from Lactobacillus plantarum BF001 Isolated from Processed Channel Catfish. J Food Prot. 1994 Aug;57(8):698-702. [Content Brief]
[2]. Heeney DD, et al. Sensitivity to the two peptide bacteriocin plantaricin EF is dependent on CorC, a membrane-bound, magnesium/cobalt efflux protein. Microbiologyopen. 2019 Nov;8(11):e827. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Plantaricin F Related Classifications
HY-P11547 Related Classifications
Powered by Bioz