6Ckine/CCL21A Protein, Mouse (sf9)
6Ckine/CCL21A Protein, Mouse (sf9) is a homeostatic lymphoid chemokine that contributes to the entry of T cells and dendritic cells into the lymphoid T-zone. It acts through chemokine receptors CCR7 and CXCR3 to promote fibrogenic and inflammatory cytokine production. 6Ckine/CCL21A Protein, Mouse (sf9) is a recombinant mouse 6Ckine/CCL21A (S24-G133) expressed by Sf9 insect cells.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
6Ckine/CCL21A Protein, Mouse (sf9) is a homeostatic lymphoid chemokine that contributes to the entry of T cells and dendritic cells into the lymphoid T-zone. It acts through chemokine receptors CCR7 and CXCR3 to promote fibrogenic and inflammatory cytokine production. 6Ckine/CCL21A Protein, Mouse (sf9) is a recombinant mouse 6Ckine/CCL21A (S24-G133) expressed by Sf9 insect cells[1].
Background
CCL21, also known as exodus-2 and secondary lymphoid chemokine (SLC), is a small cytokine belonging to the CC chemokine family and is located on chromosome 9 in the human genome. It binds to glycosaminoglycan (GAG) and is anchored to the surface of endothelial cells. As a chemokine, CCL21 inhibits hematopoiesis and stimulates chemotaxis, and is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages or neutrophils. At the same time, CCL21 is a potent stimulator of T cell migration and adhesion, binding to the glycoprotein PSGL-1 on T cells to promote the migration of T cells to secondary lymphoid organs. CCL21 can act through chemokine receptors CCR7 and CXCR3. Among them, CCR7 is a GPCR that is normally expressed by T cell subsets central memory cells, thymic T cells, B cells, mature DCs and other rare cell subsets. ccl21 can function as a microglia activator in the CNS and is expressed exclusively in endangered or mechanically damaged neurons[1][2].
In Vitro
CCL21 (intrathecal administration, .6 μg/mouse, once, 14 days) results in a significant and instantaneous decrease in paw withdrawal threshold (PWT) to .93 g, which returns to the control value of 1.44 g within 48 hours in wild-type C57BL/6 mice, also causes a rapid decrease in PWT to .721 g and does not show any recovery throughout the experiment in paucity of lymphoid T cells (plt) mutation mice[2].
CCL21 (antibodies neutralization 1 μg/injection, twice weekly) reduces Pancreatic ductal adenocarcinoma (PDAC)-induced abdominal hypersensitivity, alleviates pain associated with pancreatic ductal adenocarcinoma and improves health status in situ mouse model of PDAC in C57BL/6 mice injected with K8484 cells[3].
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
P84444 (S24-G133)
-
Molecular Construction
-
N-term
-
CC21A (S24-G133)
Accession # P84444 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Scya21a; Scya21; Ccl21a; TCA4; Thymus-derived chemotactic agent 4; Small-inducible cytokine A21a; Beta-chemokine exodus-2; 6Ckine; C-C motif chemokine 21a
-
AA Sequence
SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
-
Predicted Molecular Mass
12.1 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Balsam Rizeq, et al. The Role of CCL21/CCR7 Chemokine Axis in Breast Cancer Progression. Cancers (Basel). 2020 Apr 23;12(4):1036. [Content Brief]
[2]. Knut Biber, et al. Neuronal CCL21 up-regulates microglia P2X4 expression and initiates neuropathic pain development. EMBO J. 2011 May 4;30(9):1864-73. [Content Brief]
[3]. Michael Hirth, et al. CXCL10 and CCL21 Promote Migration of Pancreatic Cancer Cells Toward Sensory Neurons and Neural Remodeling in Tumors in Mice, Associated With Pain in Patients. Gastroenterology. 2020 Aug;159(2):665-681.e13. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)