1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. TGF-beta Superfamily Enzyme-linked receptors
  4. Activin/Inhibins & Receptors Type I RSTKs
  5. Activin RIB/ALK-4 Protein, Human (HEK293, His)

Activin RIB/ALK-4 Protein, Human (HEK293, His)

Cat. No.: HY-P7485
Handling Instructions

Activin RIB/ALK-4 Protein, Human (HEK293, His) is activin type IB receptor that produced in HEK293 cells with a His tag. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-β (TGF-β) superfamily of structurally related signaling proteins[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $75 In-stock
Estimated Time of Arrival: December 31
50 μg $160 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

HEK 293

Accession

P36896 (S24-E126)

Gene ID

91

Synonyms
rHuActivin Receptor IB, His; ALK-4; Activin RIB; ACVR1B
AA Sequence

SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVEHHHHHH

Molecular Weight

14-20 kDa

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include two type I and two type II receptors[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Activin RIB/ALK-4 Protein, Human (HEK293, His)
Cat. No.:
HY-P7485
Quantity:
MCE Japan Authorized Agent: