AKT3 Protein, Mouse (Active, sf9)
The AKT3 protein is part of the AKT kinase family and regulates a variety of cellular processes, including metabolism, proliferation, and survival.Its least-studied isoform, AKT3, is critical for brain development and is critical for the viability of malignant glioma cells.AKT3 Protein, Mouse (sf9) is the recombinant mouse-derived AKT3 protein, expressed by Sf9 insect cells , with tag free.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The AKT3 protein is part of the AKT kinase family and regulates a variety of cellular processes, including metabolism, proliferation, and survival.Its least-studied isoform, AKT3, is critical for brain development and is critical for the viability of malignant glioma cells.AKT3 Protein, Mouse (sf9) is the recombinant mouse-derived AKT3 protein, expressed by Sf9 insect cells , with tag free.
AKT3, a member of the AKT kinase family alongside AKT1 and AKT2, is a serine/threonine-protein kinase that orchestrates a myriad of essential cellular processes, including metabolism, proliferation, cell survival, growth, and angiogenesis. Its influence is exerted through the phosphorylation of numerous downstream substrates, with over 100 potential candidates identified, though most lack reported isoform specificity. Despite being the least studied isoform, AKT3 emerges as a pivotal player in brain development and proves indispensable for the viability of malignant glioma cells. Notably, it may serve as a central mediator in the up-regulation and down-regulation of MMP13 via IL13. Moreover, AKT3 plays a crucial role in coordinating mitochondrial biogenesis with heightened cellular energy demands triggered by growth factors. Silencing AKT3 expression through RNA interference down-regulates the phosphorylated form of BAD, culminating in the induction of caspase-dependent apoptosis, underscoring its multifaceted and significant regulatory functions.
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
Q9WUA6-1 (A106-E479)
-
Molecular Construction
-
N-term
-
AKT3 (A106-E479)
Accession # Q9WUA6-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
AKT3; V-Akt Murine Thymoma Viral Oncogene Homolog 3; AKT Serine/Threonine Kinase 3; Non-Specific Serine/Threonine Protein Kinase; PKBG; RAC-Gamma Serine/Threonine Protein Kinase; RAC-Gamma; Protein Kinase B, Gamma; PRKBG; Protein Kinase B Gamma; RAC-Gamma
-
AA Sequence
ADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDDDGMDGMDNERRPHFPQFSYSASGRE
-
Predicted Molecular Mass
43.4 kDa
-
Molecular Weight
Approximately 46 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
