Animal-Free IL-22 Protein, Human (His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-22 Protein, Human (His) is 146 a.a., with molecular weight of ~17.83 kDa.

IL-22 Protein assumes a pivotal role in modulating tissue responses during inflammation, demonstrating a crucial involvement in the regeneration of epithelial cells to preserve barrier function following injury and forestall further tissue damage. Unlike most cytokines, IL-22 exerts no influence on immune cells, relying on a heterodimeric receptor comprising the specific IL22RA1 receptor, found on non-immune cells in various organs, and the shared subunit IL10RB. The binding of IL-22 to IL22RA1 activates the tyrosine kinases JAK1 and TYK2, subsequently triggering STAT3 activation. This, in turn, promotes cell survival and proliferation through the STAT3, ERK1/2, and PI3K/AKT pathways, contributing to the phosphorylation of GSK3B at 'Ser-9' and CTTN. Additionally, IL-22 fosters epithelial cell spreading.

Measure by its ability to induce proliferation in A549 cells. The ED₅₀ for this effect is <0.5 ng/mL.

Human

E. coli

C-His

Q9GZX6 (A34-I179)

50616  [NCBI]

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Approximately 17.83 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.