1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-22
  5. Animal-Free IL-22 Protein, Mouse (His)

IL-22 Protein is an secreted IL-10 family cytokine that take part in inflammation responses, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells. IL22 promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. Animal-Free IL-22 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
2 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

IL-22 Protein is an secreted IL-10 family cytokine that take part in inflammation responses, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells. IL22 promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. Animal-Free IL-22 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

IL-22 is a secreted IL-10 family cytokine that plays a critical role in modulating tissue responses during inflammation, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells[1][2][3][4].
IL-22 is produced by several T cells, ILC3, neutrophils and macrophages, IL-22 has a specific receptor which is composed of IL-22R1 and IL-10R2, presenting on non-immune cells in many organs. Ligation of IL22RA1 with IL22 induces activation of the tyrosine kinases JAK1 and TYK2, which activates STAT3, and p38 MAPK, in turn, promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 promotes phosphorylation of GSK3B at 'Ser-9' and CTTN as well[5].
IL-22 gets positive regulation from IL-23, IL-1β, IL-7, AhR and Notch, IL-22 gets negative regulation from IL-22BP, TGF-β, IL-27, ICOS, c-Maf and IL-25[6].

Biological Activity

Measure by its ability to induce IL-10 secretion in COLO205 cells. The ED50 for this effect is <0.3 ng/mL.

Species

Mouse

Source

E. coli

Tag

C-6*His

Accession

Q9JJY9 (L34-V179)

Gene ID
Molecular Construction
N-term
IL-22 (L34-V179)
Accession # Q9JJY9
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuIL-22; Cytokine Zcyto 18; IL-TIF
AA Sequence

LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV

Predicted Molecular Mass
17.6 kDa
분자량

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

Animal-Free IL-22 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Animal-Free IL-22 Protein, Mouse (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Animal-Free IL-22 Protein, Mouse (His)
Cat. No.:
HY-P7079AF
수량:
MCE Japan Authorized Agent: