Copy Link Print Information

B7-H6 Protein, Human (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

B7-H6, a distinctive monomeric protein, uniquely triggers NCR3-dependent natural killer (NK) cell activation, specifically interacting with NCR3 while avoiding engagement with other NK cell-activating receptors (NCR1, NCR2, and KLRK1). This specificity underscores B7-H6's unique role in initiating NK cell responses through the NCR3 pathway within the intricate network of NK cell activation mechanisms. B7-H6 Protein, Human (HEK293, Fc) is the recombinant human-derived B7-H6 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for B7-H6 Protein, Human (HEK293, Fc)
  • B7-H6 Protein, Human (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

B7-H6, a distinctive monomeric protein, uniquely triggers NCR3-dependent natural killer (NK) cell activation, specifically interacting with NCR3 while avoiding engagement with other NK cell-activating receptors (NCR1, NCR2, and KLRK1). This specificity underscores B7-H6's unique role in initiating NK cell responses through the NCR3 pathway within the intricate network of NK cell activation mechanisms. B7-H6 Protein, Human (HEK293, Fc) is the recombinant human-derived B7-H6 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

B7-H6, a distinctive protein, serves as a trigger for NCR3-dependent natural killer (NK) cell activation. Operating as a monomer, B7-H6 exhibits a specific interaction with NCR3, distinctly avoiding engagement with other NK cell-activating receptors, such as NCR1, NCR2, and KLRK1. This interaction highlights its unique role in initiating NK cell responses through the NCR3 pathway, showcasing its specificity in the intricate network of NK cell activation mechanisms.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized human NCR3 at 10μg/mL (100μL/well) can bind B7-H6 Protein, Human (HEK293, Fc) and the EC50 is 20-100ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession

    Q68D85 (D25-S262)

  • Gene ID
    374383  [NCBI]
  • Molecular Construction
    • N-term
    • B7-H6 (D25-S262)
      Accession # Q68D85
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    NCR3LG1; B7 Homolog 6; Natural Killer Cell Cytotoxicity Receptor 3 Ligand 1; Natural Cytotoxicity Triggering Receptor 3 Ligand 1; B7-H6; B7H6; DKFZp686O24166; Putative Ig-Like Domain-Containing Protein DKFZp686O24166/DKFZp686I21167

  • AA Sequence

    DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS

  • Predicted Molecular Mass

    53.4 kDa

  • Molecular Weight

    78-95 kDa

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • B7-H6 Protein, Human (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for B7-H6 Protein, Human (HEK293, Fc)
  • B7-H6 Protein, Human (HEK293, Fc) Product Image