1. Protéines recombinantes
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Neurotrophins/NGF
  5. Brain Derived Neurotrophic Factor (BDNF)
  6. BDNF Protein, Mouse (R129A, R130A, HEK293, His, Solution)

BDNF Protein, Mouse (R129A, R130A, HEK293, His, Solution)

Cat. No.: HY-P74383
Instruction de manipulation Technical Support

Brain Derived Neurotrophic Factor (BDNF) is a neurotrophin that belongs to NGF-beta family. BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt). BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB. BDNF is a neurotransmitter modulator, and is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory. BDNF is widely expressed in the CNS. BDNF Protein, Mouse (R129A, R130A, HEK293, His) is a recombinant mouse BDNF (M1-R249, R129A, R130A) with C-terminal His tag, which is produced in HEK293.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Prix Stock Quantité
2 μg En stock
5 μg En stock
10 μg En stock
50 μg En stock
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products

3 Publications Citing Use of MCE BDNF Protein, Mouse (R129A, R130A, HEK293, His, Solution)

  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

  • Références

Description

Brain Derived Neurotrophic Factor (BDNF) is a neurotrophin that belongs to NGF-beta family. BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt)[1]. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB[2]. BDNF is a neurotransmitter modulator, and is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory. BDNF is widely expressed in the CNS[1]. BDNF Protein, Mouse (R129A, R130A, HEK293, His) is a recombinant mouse BDNF (M1-R249, R129A, R130A) with C-terminal His tag, which is produced in HEK293.

Background

BDNF, a neurotrophin that belongs to NGF-beta family. BDNF is widely expressed in the CNS, gut and other tissues. BDNF regulates neurodevelopmental processes, including maturation, survival and differentiation of neuronal populations, and synaptic plasticity[1].
BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt), thereby inducing increased Ca2+ intake and phosphorylation of transcription factors. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB. The activation of p75NTR increases apoptotic and inflammatory signaling in neurons and glial cells by activation of c-Jun N-terminal kinases (JNK) and NF-κB expression, respectively[2]. In BDNF knockout mouse, recombinant BDNF rescues deficits in basal synaptic transmission and hippocampal LTP[3]. Mouse BDNF shares >97% aa sequence identity with human. Mouse BDNF shares >99% aa sequence identity with rat.
BDNF is a neurotransmitter modulator which is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory[1].

In Vitro

BDNF (mouse, 1 ng/mL, 3 min-2 h hippocampal slices from BDNF knockout mice) significantly improves deficits in basal synaptic transmission at the Schaffer collateral–CA1 synapse [3].

In Vivo

BDNF (mouse, 0.25 μg/side, intrahippocampal administration) mimics the beneficial effects (improve cognition) of NSC transplantation in AD mice[4].

Activité biologique

Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with TrkB. The ED50 for this effect is 4.391 ng/mL, corresponding to a specific activity is 2.277×105 units/mg.

  • Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with TrkB. The ED50 for this effect is 4.391 ng/mL, corresponding to a specific activity is 2.277×105 units/mg.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

P21237-1 (A19-R249, R129A, R130A)

Gene ID
Molecular Construction
N-term
BDNF (A19-R249, R129A, R130A)
Accession # P21237-1
His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Brain-derived neurotrophic factor; BDNF; ProBDNF
AA Sequence

APMKEVNVHGQGNLAYPGVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVAAHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Predicted Molecular Mass
27.4 kDa
Masse moléculaire

Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Pureté
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Livraison

Shipping with dry ice.

Documentation
Références

BDNF Protein, Mouse (R129A, R130A, HEK293, His, Solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

BDNF Protein, Mouse (R129A, R130A, HEK293, His, Solution)

 

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

     

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
BDNF Protein, Mouse (R129A, R130A, HEK293, His, Solution)
Cat. No.:
HY-P74383
Quantité:
MCE Japan Authorized Agent: