CDKN2C Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The CDKN2C protein (also known as p18) interacts strongly with CDK6 and weakly with CDK4. Its functional effects inhibit cell growth and proliferation and are significantly related to the presence of endogenous retinoblastoma protein RB. CDKN2C Protein, Human (His) is the recombinant human-derived CDKN2C protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CDKN2C protein (also known as p18) interacts strongly with CDK6 and weakly with CDK4. Its functional effects inhibit cell growth and proliferation and are significantly related to the presence of endogenous retinoblastoma protein RB. CDKN2C Protein, Human (His) is the recombinant human-derived CDKN2C protein, expressed by E. coli , with N-6*His labeled tag.

Background

The CDKN2C protein, also known as p18, exerts strong interactions with CDK6 and exhibits a weaker interaction with CDK4. Its functional impact manifests in the inhibition of cell growth and proliferation, with a noteworthy correlation dependent on the presence of the endogenous retinoblastoma protein RB. The formation of a heterodimeric complex between p18 and CDK6 underscores its role as a regulator in cell cycle progression. This interaction highlights the significance of CDKN2C in modulating key cellular processes, particularly in controlling the activity of cyclin-dependent kinases and influencing the dynamics of cell proliferation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • CDKN2C (M1-Q168)
      Accession # P42773
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CDKN2C; P18-INK4c; Cyclin Dependent Kinase Inhibitor 2C; Cyclin-Dependent Kinase 6 Inhibitor P18; Cyclin-Dependent Kinase 4 Inhibitor C; Cyclin-Dependent Kinase Inhibitor 2C; P18-INK6; Cyclin-Dependent Inhibitor; INK4C; CDK6 Inhibitor P18; P18; P18-INK4C;

  • AA Sequence

    MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ

  • Predicted Molecular Mass

    20.3 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00