CSF1R Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
The CSF1R protein is a tyrosine protein kinase receptor for CSF1 and IL34 and plays a critical regulatory role in hematopoietic cells, especially mononuclear phagocytes. Its effects span innate immunity, inflammation, osteoclast function, skeletal development, and fertility. CSF1R Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CSF1R protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CSF1R protein is a tyrosine protein kinase receptor for CSF1 and IL34 and plays a critical regulatory role in hematopoietic cells, especially mononuclear phagocytes. Its effects span innate immunity, inflammation, osteoclast function, skeletal development, and fertility. CSF1R Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CSF1R protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CSF1R protein, a tyrosine-protein kinase, serves as a cell-surface receptor for CSF1 and IL34, exerting pivotal control over the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes like macrophages and monocytes. Its role in innate immunity and inflammatory processes is underscored by its promotion of the release of pro-inflammatory chemokines in response to IL34 and CSF1. Additionally, CSF1R plays a critical role in the regulation of osteoclast proliferation and differentiation, bone resorption, and is indispensable for normal bone and tooth development. It is essential for normal fertility in both males and females, as well as for the development of milk ducts and acinar structures in the mammary gland during pregnancy. Notably, CSF1R influences the reorganization of the actin cytoskeleton, regulates the formation of membrane ruffles, cell adhesion, cell migration, and facilitates cancer cell invasion. Upon ligand binding, CSF1R activates multiple signaling pathways, including ERK1/2, JNK, PI3K/AKT, MAP kinases (MAPK1/ERK2 and/or MAPK3/ERK1), and SRC family kinases (SRC, FYN, YES1). Its downstream effects involve the phosphorylation of various target proteins, such as PIK3R1, PLCG2, GRB2, SLA2, and CBL. Furthermore, CSF1R mediates the activation of STAT family members (STAT3, STAT5A, and/or STAT5B) and promotes tyrosine phosphorylation of SHC1 and INPP5D/SHIP-1. The receptor signaling is tightly regulated by protein phosphatases, including INPP5D/SHIP-1, and by the rapid internalization of the activated receptor. In the central nervous system, CSF1R may contribute to the development of microglia macrophages.
Verified Bioactivity
1.This product does not contain protein kinase domain.
2.Measured by its ability to inhibit the mouse CSF-induced proliferation of M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is typically 0.1-0.7 μg/mL in the presence of 15 ng/mL mouse M-CSF.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
P09581 (A20-S511)
-
Molecular Construction
-
N-term
-
CSF1R (A20-S511)
Accession # P09581 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CSF1R; CSF-1R; Prev. FMS; Macrophage Colony Stimulating Factor I Receptor; C-FMS; Colony Stimulating Factor Receptor; CD115; Receptor Protein-Tyrosine Kinase; CSFR; FMS Proto-Oncogene; McDonough Feline Sarcoma Viral (V-Fms) Oncogene Homolog; BANDDOS; Macr
-
AA Sequence
APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES
-
Predicted Molecular Mass
81.9 kDa
-
Molecular Weight
Approximately 100-130 kDa under reduced (R) conditions, 260 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% Mannitol, 0.01% Tween-80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)