EP300 Protein, Human (His)

EP300 Protein, Human (His) is the recombinant human-derived EP300, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

EP300 Protein, Human (His) is the recombinant human-derived EP300, expressed by E. coli , with N-6*His labeled tag.

Background

p300 functions as a histone acetyltransferase that regulates transcription through chromatin remodeling. It acetylates all four core histones in nucleosomes, including histone H3 at Lys-122 (H3K122ac), Lys-18 (H3K18ac), and Lys-27 (H3K27ac), as well as histone H4 at Lys-5 (H4K5acme) and Lys-12 (H4K12acme), promoting transcriptional activation partly by enhancing nucleosome instability. Additionally, p300 acetylates non-histone targets such as ALX1, HDAC1, PRMT1, SIRT2, STAT3, and GLUL, modulating their functions. For example, acetylation of SIRT2 indirectly enhances p53/TP53 transcriptional activity, while STAT3 acetylation promotes dimerization and activation. p300 is involved in DNA damage response, heat shock response (HSR), circadian gene transcription, and the TGF-β signaling pathway. Beyond acetylation, p300 utilizes different acyl-CoA substrates (e.g., crotonyl-CoA, butyryl-CoA, 2-hydroxyisobutyryl-CoA, lactoyl-CoA, or propionyl-CoA) to mediate protein crotonylation, butyrylation, 2-hydroxyisobutyrylation, lactylation, or propionylation. During microbial infection, p300 is recruited by HIV-1 Tat protein to regulate its transactivating activity.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • EP300 (K1046-C1163)
      Accession # Q09472
    • C-term
  • Protein Length

    Partial

  • Synonyms

    EP300; Histone Crotonyltransferase P300; EP300 Lysine Acetyltransferase; Histone Butyryltransferase P300; P300; Protein Lactyltransferas P300; Histone Acetyltransferase P300; E1A-Associated Protein P300; E1A Binding Protein P300; P300 HAT; KAT3B; E1A-Bind

  • AA Sequence

    KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYC

  • Predicted Molecular Mass

    15.1 kDa

  • Molecular Weight

    Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00