EP300 Protein, Human (His)
EP300 Protein, Human (His) is the recombinant human-derived EP300, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
EP300 Protein, Human (His) is the recombinant human-derived EP300, expressed by E. coli , with N-6*His labeled tag.
Background
p300 functions as a histone acetyltransferase that regulates transcription through chromatin remodeling. It acetylates all four core histones in nucleosomes, including histone H3 at Lys-122 (H3K122ac), Lys-18 (H3K18ac), and Lys-27 (H3K27ac), as well as histone H4 at Lys-5 (H4K5acme) and Lys-12 (H4K12acme), promoting transcriptional activation partly by enhancing nucleosome instability. Additionally, p300 acetylates non-histone targets such as ALX1, HDAC1, PRMT1, SIRT2, STAT3, and GLUL, modulating their functions. For example, acetylation of SIRT2 indirectly enhances p53/TP53 transcriptional activity, while STAT3 acetylation promotes dimerization and activation. p300 is involved in DNA damage response, heat shock response (HSR), circadian gene transcription, and the TGF-β signaling pathway. Beyond acetylation, p300 utilizes different acyl-CoA substrates (e.g., crotonyl-CoA, butyryl-CoA, 2-hydroxyisobutyryl-CoA, lactoyl-CoA, or propionyl-CoA) to mediate protein crotonylation, butyrylation, 2-hydroxyisobutyrylation, lactylation, or propionylation. During microbial infection, p300 is recruited by HIV-1 Tat protein to regulate its transactivating activity.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q09472 (K1046-C1163)
-
Gene ID2033
-
Molecular Construction
-
N-term
-
6*His
-
EP300 (K1046-C1163)
Accession # Q09472 -
C-term
-
-
Protein Length
Partial
-
Synonyms
EP300; Histone Crotonyltransferase P300; EP300 Lysine Acetyltransferase; Histone Butyryltransferase P300; P300; Protein Lactyltransferas P300; Histone Acetyltransferase P300; E1A-Associated Protein P300; E1A Binding Protein P300; P300 HAT; KAT3B; E1A-Bind
-
AA Sequence
KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYC
-
Predicted Molecular Mass
15.1 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)