FGF-1 Protein, Human (154a.a)
Based on 2 publication(s) in Google Scholar
FGF-1 protein complexly regulates cell survival, division, angiogenesis, differentiation, and migration. As a potent mitogen, it acts as a ligand for FGFR1 and integrins. FGF-1 Protein, Human (154a.a) is the recombinant human-derived FGF-1 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FGF-1 protein complexly regulates cell survival, division, angiogenesis, differentiation, and migration. As a potent mitogen, it acts as a ligand for FGFR1 and integrins. FGF-1 Protein, Human (154a.a) is the recombinant human-derived FGF-1 protein, expressed by E. coli , with tag free.
Background
FGF-1 Protein assumes a pivotal role in intricately regulating cell survival, division, angiogenesis, differentiation, and migration. Functioning as a potent mitogen in vitro, it acts as a ligand for FGFR1 and integrins. Binding to FGFR1, particularly in the presence of heparin, leads to FGFR1 dimerization and activation through sequential autophosphorylation on tyrosine residues. This activation serves as docking sites for interacting proteins, initiating several signaling cascades. Furthermore, FGF-1 Protein binds to integrin ITGAV:ITGB3, forming a ternary complex with integrin and FGFR1, crucial for FGF1 signaling. Inducing the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2, and AKT1, it demonstrates its involvement in diverse cellular processes. Additionally, FGF-1 Protein's ability to induce angiogenesis further underscores its multifaceted role. Interactions with FGFRs, integrins, and various proteins within complex networks highlight its intricate participation in cellular signaling pathways, emphasizing its significance in cell physiology.
Verified Bioactivity
Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblasts cells. The ED50 for this effect is 0.0273 ng/mL in the presence of 10 µg/mL of heparin. corresponding to a specific activity is 3.66×107 units/mg.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Cell
2026 Mar 5;189(5):1573-1590.e24. PMID: 41702400 -
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P05230-1 (A2-D155)
-
Molecular Construction
-
N-term
-
FGF-1 (A2-D155)
Accession # P05230-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
FGF1; Endothelial Cell Growth Factor, Alpha; Prev. FGFA; Fibroblast Growth Factor 1 (Acidic); Heparin-Binding Growth Factor 1; Acidic Fibroblast Growth Factor; AFGF; HBGF-1; ECGF; FGF-1; ECGF-Beta; Beta-Endothelial Cell Growth Factor; FGF-Alpha; Endotheli
-
AA Sequence
AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
-
Predicted Molecular Mass
17.3 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
