Frizzled-5 Protein, Human (HEK293, Fc)

Frizzled-5 protein is a receptor for Wnt proteins (WNT2, WNT10B, WNT5A), which can activate WNT7A and promote the formation of synapses in neurons. It participates in the canonical Wnt/β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target genes. Frizzled-5 Protein, Human (HEK293, Fc) is the recombinant human-derived Frizzled-5 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Frizzled-5 protein is a receptor for Wnt proteins (WNT2, WNT10B, WNT5A), which can activate WNT7A and promote the formation of synapses in neurons. It participates in the canonical Wnt/β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target genes. Frizzled-5 Protein, Human (HEK293, Fc) is the recombinant human-derived Frizzled-5 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Frizzled-5 Protein functions as a receptor for Wnt proteins, including WNT2, WNT10B, and WNT5A, although it does not activate WNT2B or WNT4 in vitro, and the in vivo context may vary due to potential differences in coexpression. In neurons, the activation of WNT7A by Frizzled-5 promotes synapse formation. It actively participates in the canonical Wnt/beta-catenin signaling pathway, leading to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and subsequent activation of Wnt target genes. Frizzled-5 may also engage a secondary signaling pathway involving PKC and calcium fluxes, the integration of which with the canonical pathway remains unclear, given PKC's apparent requirement for Wnt-mediated inactivation of GSK-3 kinase. This versatile receptor likely plays a role in transduction and intercellular transmission of polarity information during tissue morphogenesis and in differentiated tissues. Additionally, Frizzled-5 is implicated in yolk sac angiogenesis and placental vascularization, and its homodimerization is promoted by the binding of unsaturated fatty acid molecules via the FZ domain. Notably, Frizzled-5 interacts with WNT2B, WNT7A, and GOPC, contributing to its diverse range of cellular functions.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Frizzled-5 (A27-P167)
      Accession # Q13467
    • hFc
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    FZD5; FzE5; Prev. C2orf31; Chromosome 2 Open Reading Frame 31; HFZ5; Frizzled (Drosophila) Homolog 5; Frizzled 5, Seven Transmembrane Spanning Receptor; Frizzled Homolog 5 (Drosophila); Frizzled Family Receptor 5; Wnt Receptor; DKFZP434E2135; MCOPCB11; Fr

  • AA Sequence

    ASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKP

  • Predicted Molecular Mass

    42.7 kDa

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00