1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Frizzled
  5. Frizzled-5
  6. Frizzled-5 Protein, Mouse (CHO, Fc)

Frizzled-5 is a Wnt receptor that activates canonical Wnt/β-catenin signaling through WNT2, WNT10B, and WNT5A. It participates in a potential second pathway involving PKC and calcium flux, affecting Wnt-mediated inactivation of GSK-3 kinase. Frizzled-5 Protein, Mouse (CHO, Fc) is the recombinant mouse-derived Frizzled-5 protein, expressed by CHO , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Frizzled-5 is a Wnt receptor that activates canonical Wnt/β-catenin signaling through WNT2, WNT10B, and WNT5A. It participates in a potential second pathway involving PKC and calcium flux, affecting Wnt-mediated inactivation of GSK-3 kinase. Frizzled-5 Protein, Mouse (CHO, Fc) is the recombinant mouse-derived Frizzled-5 protein, expressed by CHO , with C-hFc labeled tag.

Background

Frizzled-5, a receptor for Wnt proteins, demonstrates a nuanced activation profile, being responsive to WNT2, WNT10B, and WNT5A, while showing no affinity for WNT2B or WNT4 in vitro. Its involvement in canonical Wnt/beta-catenin signaling is pivotal, leading to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and subsequent activation of Wnt target genes. Additionally, a second signaling pathway, potentially involving PKC and calcium fluxes, adds complexity, with implications for Wnt-mediated inactivation of GSK-3 kinase. Frizzled-5's engagement in tissue morphogenesis and potential participation in transducing polarity information underscores its versatile role. Notably, in neurons, WNT7A activation facilitates synapse formation. Its contributions extend to yolk sac angiogenesis and placental vascularization. Homodimerization, facilitated by binding of unsaturated fatty acid molecules, and interactions with WNT2B, WNT7A, and GOPC further underscore the multifaceted regulatory functions of Frizzled-5 within intricate signaling networks.

Species

Mouse

Source

CHO

Tag

C-hFc

Accession

Q9EQD0 (A27-P167)

Gene ID
Molecular Construction
N-term
Frizzled-5 (A27-P167)
Accession # Q9EQD0
hFc
C-term
Protein Length

Partial

Synonyms
Frizzled-5; Fz-5; mFz5; Fzd5
AA Sequence

ASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKP

분자량

52-56 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

Frizzled-5 Protein, Mouse (CHO, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Frizzled-5 Protein, Mouse (CHO, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Frizzled-5 Protein, Mouse (CHO, Fc)
Cat. No.:
HY-P74136
수량:
MCE Japan Authorized Agent: