Frizzled-5 Protein, Mouse (CHO, Fc)
Based on 1 Customer Validation
Frizzled-5 is a Wnt receptor that activates canonical Wnt/β-catenin signaling through WNT2, WNT10B, and WNT5A. It participates in a potential second pathway involving PKC and calcium flux, affecting Wnt-mediated inactivation of GSK-3 kinase. Frizzled-5 Protein, Mouse (CHO, Fc) is the recombinant mouse-derived Frizzled-5 protein, expressed by CHO , with C-hFc labeled tag.
- Species: Mouse
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Frizzled-5 is a Wnt receptor that activates canonical Wnt/β-catenin signaling through WNT2, WNT10B, and WNT5A. It participates in a potential second pathway involving PKC and calcium flux, affecting Wnt-mediated inactivation of GSK-3 kinase. Frizzled-5 Protein, Mouse (CHO, Fc) is the recombinant mouse-derived Frizzled-5 protein, expressed by CHO , with C-hFc labeled tag.
Background
Frizzled-5, a receptor for Wnt proteins, demonstrates a nuanced activation profile, being responsive to WNT2, WNT10B, and WNT5A, while showing no affinity for WNT2B or WNT4 in vitro. Its involvement in canonical Wnt/beta-catenin signaling is pivotal, leading to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and subsequent activation of Wnt target genes. Additionally, a second signaling pathway, potentially involving PKC and calcium fluxes, adds complexity, with implications for Wnt-mediated inactivation of GSK-3 kinase. Frizzled-5's engagement in tissue morphogenesis and potential participation in transducing polarity information underscores its versatile role. Notably, in neurons, WNT7A activation facilitates synapse formation. Its contributions extend to yolk sac angiogenesis and placental vascularization. Homodimerization, facilitated by binding of unsaturated fatty acid molecules, and interactions with WNT2B, WNT7A, and GOPC further underscore the multifaceted regulatory functions of Frizzled-5 within intricate signaling networks.
Technical Parameters
-
Species Mouse
-
Source CHO
-
Tag C-hFc
-
Accession
Q9EQD0 (A27-P167)
-
Molecular Construction
-
N-term
-
Frizzled-5 (A27-P167)
Accession # Q9EQD0 -
hFc
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
FZD5; FzE5; Prev. C2orf31; Chromosome 2 Open Reading Frame 31; HFZ5; Frizzled (Drosophila) Homolog 5; Frizzled 5, Seven Transmembrane Spanning Receptor; Frizzled Homolog 5 (Drosophila); Frizzled Family Receptor 5; Wnt Receptor; DKFZP434E2135; MCOPCB11; Fr
-
AA Sequence
ASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKP
-
Predicted Molecular Mass
42.9 kDa
-
Molecular Weight
Approximately 52-56 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)