Frizzled-5 Protein, Mouse (CHO, Fc)

Customer Review

Based on 1 Customer Validation

Frizzled-5 is a Wnt receptor that activates canonical Wnt/β-catenin signaling through WNT2, WNT10B, and WNT5A. It participates in a potential second pathway involving PKC and calcium flux, affecting Wnt-mediated inactivation of GSK-3 kinase. Frizzled-5 Protein, Mouse (CHO, Fc) is the recombinant mouse-derived Frizzled-5 protein, expressed by CHO , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Frizzled-5 is a Wnt receptor that activates canonical Wnt/β-catenin signaling through WNT2, WNT10B, and WNT5A. It participates in a potential second pathway involving PKC and calcium flux, affecting Wnt-mediated inactivation of GSK-3 kinase. Frizzled-5 Protein, Mouse (CHO, Fc) is the recombinant mouse-derived Frizzled-5 protein, expressed by CHO , with C-hFc labeled tag.

Background

Frizzled-5, a receptor for Wnt proteins, demonstrates a nuanced activation profile, being responsive to WNT2, WNT10B, and WNT5A, while showing no affinity for WNT2B or WNT4 in vitro. Its involvement in canonical Wnt/beta-catenin signaling is pivotal, leading to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and subsequent activation of Wnt target genes. Additionally, a second signaling pathway, potentially involving PKC and calcium fluxes, adds complexity, with implications for Wnt-mediated inactivation of GSK-3 kinase. Frizzled-5's engagement in tissue morphogenesis and potential participation in transducing polarity information underscores its versatile role. Notably, in neurons, WNT7A activation facilitates synapse formation. Its contributions extend to yolk sac angiogenesis and placental vascularization. Homodimerization, facilitated by binding of unsaturated fatty acid molecules, and interactions with WNT2B, WNT7A, and GOPC further underscore the multifaceted regulatory functions of Frizzled-5 within intricate signaling networks.

Technical Parameters

  • Species Mouse
  • Source CHO
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Frizzled-5 (A27-P167)
      Accession # Q9EQD0
    • hFc
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    FZD5; FzE5; Prev. C2orf31; Chromosome 2 Open Reading Frame 31; HFZ5; Frizzled (Drosophila) Homolog 5; Frizzled 5, Seven Transmembrane Spanning Receptor; Frizzled Homolog 5 (Drosophila); Frizzled Family Receptor 5; Wnt Receptor; DKFZP434E2135; MCOPCB11; Fr

  • AA Sequence

    ASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKP

  • Predicted Molecular Mass

    42.9 kDa

  • Molecular Weight

    Approximately 52-56 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00