Copy Link Print Information

Frizzled-7 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Frizzled-7 (FZD7) is a Wnt receptor that primarily activates the β-catenin classical pathway, involving Disheveled protein, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Some family members exhibit a second PKC and calcium flux signaling pathway, but the integration is unclear. Frizzled-7/FZD7 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-7/FZD7 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Frizzled-7 Protein, Human (HEK293, His)
  • Experimental Validation Results for Frizzled-7 Protein, Human (HEK293, His)
  • Frizzled-7 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Frizzled-7 (FZD7) is a Wnt receptor that primarily activates the β-catenin classical pathway, involving Disheveled protein, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Some family members exhibit a second PKC and calcium flux signaling pathway, but the integration is unclear. Frizzled-7/FZD7 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-7/FZD7 protein, expressed by HEK293 , with C-His labeled tag.

Background

Frizzled-7 (FZD7), serving as a receptor for Wnt proteins, predominantly operates through the beta-catenin canonical signaling pathway, initiating a cascade that involves disheveled proteins, GSK-3 kinase inhibition, nuclear accumulation of beta-catenin, and the activation of Wnt target genes. While a second signaling pathway involving PKC and calcium fluxes has been observed in some family members, its distinctiveness and potential integration with the canonical pathway remain unclear, with PKC seemingly required for Wnt-mediated GSK-3 kinase inactivation. Activation by WNT8 induces the expression of beta-catenin target genes. Upon ligand activation, FZD7 interacts with CCDC88C/DAPLE, displacing DVL1 and inhibiting canonical Wnt signaling, leading to G-protein activation by CCDC88C and the initiation of non-canonical Wnt responses. This intricate involvement suggests FZD7's potential role in transducing polarity information during tissue morphogenesis and/or in differentiated tissues. Additionally, in the context of microbial infection, FZD7 acts as a receptor for C. difficile toxin TcdB in the colonic epithelium.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human Wnt-5a (HY-P702853) at 100 ng/mL (100 μL/well) on the plate can bind biotinylated Human Frizzled-7. The ED50 for this effect is <120 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human Wnt-5a (HY-P702853) at 100 ng/mL (100 μL/well) on the plate can bind biotinylated Human Frizzled-7. The ED50 for this effect is 101.3 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    O75084 (Q33-L185)

  • Gene ID
    8324  [NCBI]
  • Molecular Construction
    • N-term
    • Frizzled-7 (Q33-L185)
      Accession # O75084
    • His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    FZD7; Fz-7; Frizzled Class Receptor 7; HFz7; FzE3; Frizzled, Drosophila, Homolog Of, 7; Frizzled-7; Frizzled (Drosophila) Homolog 7; Frizzled 7, Seven Transmembrane Spanning Receptor; Frizzled Homolog 7 (Drosophila); Frizzled Family Receptor 7; Frizzled H

  • AA Sequence

    QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

  • Molecular Weight

    Approximately 25-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Human Wnt-5a (HY-P702853) at 100 ng/mL (100 μL/well) on the plate can bind biotinylated Human Frizzled-7. The ED50 for this effect is 101.3 ng/mL.

  • Frizzled-7 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Frizzled-7 Protein, Human (HEK293, His)
  • Experimental Validation Results for Frizzled-7 Protein, Human (HEK293, His)
  • Frizzled-7 Protein, Human (HEK293, His) Product Image