GMP PDGF-BB Protein, Human
Based on 1 publication(s) in Google Scholar
The PDGF-BB protein is a key growth factor that centrally regulates embryonic development, cell proliferation, migration, survival, and chemotaxis. It is known for its potent mitogenic effects on mesenchymal cells and is essential for the normal proliferation and recruitment of pericytes and vascular smooth muscle cells in tissues such as the central nervous system, skin, lungs, heart, and placenta. GMP PDGF-BB Protein, Human is the recombinant human-derived PDGF-BB protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The PDGF-BB protein is a key growth factor that centrally regulates embryonic development, cell proliferation, migration, survival, and chemotaxis. It is known for its potent mitogenic effects on mesenchymal cells and is essential for the normal proliferation and recruitment of pericytes and vascular smooth muscle cells in tissues such as the central nervous system, skin, lungs, heart, and placenta. GMP PDGF-BB Protein, Human is the recombinant human-derived PDGF-BB protein, expressed by E. coli , with tag free.
Background
GMP PDGF-BB Protein, a pivotal growth factor, assumes a central role in regulating embryonic development, cell proliferation, migration, survival, and chemotaxis. Renowned for its potent mitogenic effects on mesenchymal cells, GMP PDGF-BB is indispensable for the normal proliferation and recruitment of pericytes and vascular smooth muscle cells in various tissues, including the central nervous system, skin, lung, heart, and placenta. Its vital contributions extend to the development of blood vessels and kidney glomeruli, highlighting its significance in vascular and renal physiology. A key participant in wound healing, GMP PDGF-BB's signaling dynamics are finely tuned through heterodimer formation with PDGFA. Present as an antiparallel homodimer, GMP PDGF-BB engages in disulfide-linked interactions with PDGFRA and PDGFRB homodimers, as well as with heterodimers formed by PDGFRA and PDGFRB. Additionally, it forms antiparallel heterodimers with PDGFA, further diversifying its regulatory repertoire. Notably, GMP PDGF-BB establishes connections with XLKD1, LRP1, and SORL1, contributing to a network of interactions that modulate its multifaceted functions.
Verified Bioactivity
The specific activity is > 1.0×104 IU/mg.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Curr Issues Mol Biol
Deciphering the Mechanism of Wogonin, a Natural Flavonoid, on the Proliferation of Pulmonary Arterial Smooth Muscle Cells by Integrating Network Pharmacology and In Vitro Validation. [Abstract]2023 Jan 8;45(1):555-570. PMID: 36661523
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P01127-1 (S82-T190)
-
Molecular Construction
-
N-term
-
GMP PDGF-BB (S82-T190)
Accession # P01127-1 -
C-term
-
-
Protein Length
Full Length of PDGFB
-
Synonyms
PDGFB; Platelet-Derived Growth Factor 2; Prev. SIS; PDGF Subunit B; Platelet-Derived Growth Factor Beta Polypeptide; PDGF2; Platelet-Derived Growth Factor Subunit B; Platelet-Derived Growth Factor, Beta Polypeptide (Oncogene SIS); Platelet-Derived Growth
-
AA Sequence
SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
-
Predicted Molecular Mass
12.4 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 20 mM NaAc-HAc, pH 4.5.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM NaAc-HAc, 4% mannitol, pH 4.5.
Please refer to the lot-specific COA for specific buffer information.
<0.1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)