Copy Link Print Information

IFN-gamma R1/CD119 Protein, Human (HEK293, hFc)

Customer Review

Based on 1 Customer Validation

IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 forms the functional receptor with IFN-gamma R2. Upon binding with IFN-gamma, IFN-gamma R1 and IFN-gamma R2 oligomerize and transphosphorylate. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54). IFN-gamma R1/CD119 Protein, Human (HEK293, hFc) is a recombinant human IFN-gamma R1 (E18-G245) with C-terminal hFc tag, which is produced in HEK293 cells.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • IFN-gamma R1/CD119 Protein, Human (HEK293, hFc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 forms the functional receptor with IFN-gamma R2. Upon binding with IFN-gamma, IFN-gamma R1 and IFN-gamma R2 oligomerize and transphosphorylate[1]. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54)[2]. IFN-gamma R1/CD119 Protein, Human (HEK293, hFc) is a recombinant human IFN-gamma R1 (E18-G245) with C-terminal hFc tag, which is produced in HEK293 cells.

Background

IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 is constitutively expressed on the surface of almost all cells[1].
IFN-gamma R1 can associate with IFN-gamma R2 to form a functional receptor. Upon binding with IFN-gamma, IFNγR1 and IFNγR2 oligomerize and transphosphorylate[1]. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. The phosphorylation of IFNγR1 creates a docking site for STAT1 and leads to the phosphorylation of STAT1. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54). Mutations in the gene IFNGR1 which encodes the IFN-gamma R1 cause a primary immunodeficiency and leads to mycobacterial infection, such as Mendelian susceptibility to mycobacterial disease (MSMD)[2]
Human IFN-gamma R1 consists of extracellular domain (E18-G245), helical domain (S246-I266), and cytoplasmic domain (C267-S489). The sequence of amino acids in IFNAR1 differs in different species. Human IFN-gamma R1 shares 50% aa sequence identity with mouse. IFN-gamma R1 plays a critical role in antimicrobial, antiviral, and antitumor responses[2].

Verified Bioactivity

Immobilized Human Human IFN gamma, His Tag at 2μg/ml (100μl/well) on the plate. Dose response curve for Human IFN gamma R1, hFc Tag with the EC50 of 32.7ng/ml determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession

    P15260-1/AAH05333 (E18-G245)

  • Gene ID
    3459  [NCBI]
  • Molecular Construction
    • N-term
    • IFNGR1 (E18-G245)
      Accession # P15260-1/AAH05333
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    IFNGR1; IFN-Gamma-R1; Prev. IFNGR; Interferon Gamma Receptor 1 Isoform 2; CD119; Immune Interferon Receptor 1; Interferon-Gamma Receptor Alpha Chain; Antiviral Protein, Type 2; Interferon Gamma Receptor Alpha-Chain; AVP, Type 2; IFN-Gamma Receptor 1; IMD2

  • AA Sequence

    EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG

  • Predicted Molecular Mass

    52.4 kDa

  • Molecular Weight

    Approximately 60-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE or Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Castro F, et al. Interferon-Gamma at the Crossroads of Tumor Immune Surveillance or Evasion. Front Immunol. 2018 May 4;9:847. [Content Brief]

[2]. van de Vosse E, et al. IFN-γR1 defects: Mutation update and description of the IFNGR1 variation database. Hum Mutat. 2017 Oct;38(10):1286-1296. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • IFN-gamma R1/CD119 Protein, Human (HEK293, hFc) Product Image
    1/16
  • IFN-gamma R1/CD119 Protein, Human (HEK293, hFc) Product Image