IL-15 Protein, Human (Biotinylated, HEK293, His-Avi)

IL-15 protein regulates immune cells, stimulates the proliferation of NK cells, T cells, and B cells, and promotes cytokine secretion. IL-15, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived IL-15 protein, expressed by HEK293, with C-Avi;C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-15 protein regulates immune cells, stimulates the proliferation of NK cells, T cells, and B cells, and promotes cytokine secretion. IL-15, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived IL-15 protein, expressed by HEK293, with C-Avi;C-hFc labeled tag.

Background

IL-15 Protein assumes a pivotal role in orchestrating inflammatory and protective immune responses against microbial invaders and parasites, modulating immune cells across both the innate and adaptive immune systems. This cytokine stimulates the proliferation of natural killer cells, T-cells, and B-cells, while also promoting the secretion of various cytokines. Notably, IL-15, unlike most cytokines, is expressed on the surface of IL-15-producing cells in association with its high-affinity receptor IL15RA, delivering signals to target cells expressing IL2RB and IL2RG receptor subunits. Upon binding to its receptor, IL-15 triggers the phosphorylation of JAK1 and JAK3, recruiting and subsequently phosphorylating signal transducer and activator of transcription-3/STAT3 and STAT5. In monocytes, IL-15 induces the production of IL8 and monocyte chemotactic protein 1/CCL2, attracting neutrophils and monocytes to infection sites. Additionally, in mast cells, IL-15 induces rapid tyrosine phosphorylation of STAT6, exerting control over mast cell survival and the release of cytokines such as IL4.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-15 (N49-S162)
      Accession # P40933-1
    • His-Avi
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Conjugation

    Biotin

  • Synonyms

    IL15; Interleukin-15; Interleukin 15; MGC9721; IL-15

  • AA Sequence

    NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

  • Predicted Molecular Mass

    16.5 kDa

  • Molecular Weight

    Approximately 22-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00