IL-15 Protein, Rhesus macaque (HEK293, His)
The IL-15 protein is a cytokine that plays a key role in inflammatory and protective immune responses by regulating innate and adaptive immune cells. It stimulates the proliferation of natural killer cells, T cells and B cells, and promotes the secretion of cytokines. IL-15 Protein, Rhesus macaque (HEK293, His) is the recombinant rhesus macaque-derived IL-15 protein, expressed by HEK293, with C-His labeled tag.
- Species: Rhesus Macaque
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The IL-15 protein is a cytokine that plays a key role in inflammatory and protective immune responses by regulating innate and adaptive immune cells. It stimulates the proliferation of natural killer cells, T cells and B cells, and promotes the secretion of cytokines. IL-15 Protein, Rhesus macaque (HEK293, His) is the recombinant rhesus macaque-derived IL-15 protein, expressed by HEK293, with C-His labeled tag.
Background
The IL-15 Protein, a cytokine, plays a pivotal role in orchestrating inflammatory and protective immune responses against microbial invaders and parasites by modulating immune cells within both the innate and adaptive immune systems. Its influence extends to stimulating the proliferation of natural killer cells, T-cells, and B-cells, while also promoting the secretion of various cytokines. IL-15 exerts its effects in monocytes by inducing the production of IL8 and monocyte chemotactic protein 1/CCL2, attracting neutrophils and monocytes to infection sites. Notably, IL-15 differs from most cytokines in that it is expressed in association with its high-affinity receptor IL15RA on the surface of IL15-producing cells. This unique expression pattern allows IL-15 to deliver signals to target cells expressing IL2RB and IL2RG receptor subunits. Upon binding to its receptor, IL-15 triggers the phosphorylation of JAK1 and JAK3, recruiting and subsequently phosphorylating signal transducer and activator of transcription-3/STAT3 and STAT5. Additionally, in mast cells, IL-15 induces rapid tyrosine phosphorylation of STAT6, exerting control over mast cell survival and the release of cytokines such as IL4.
Technical Parameters
-
Species Rhesus Macaque
-
Source HEK293
-
Tag C-His
-
Accession
P48092 (N49-S162)
-
Gene ID699616
-
Molecular Construction
-
N-term
-
IL-15 (N49-S162)
Accession # P48092 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL15; Interleukin-15; Interleukin 15; MGC9721; IL-15
-
AA Sequence
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
-
Predicted Molecular Mass
14.9 kDa
-
Molecular Weight
Approximately 14 kDa & 16-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)