IL-17F Protein, Human (H161R, HEK293, His)
IL-17F protein is a key effector cytokine in innate and adaptive immunity that maintains tissue integrity and protects against microorganisms. It acts through the IL17RA-IL17RC receptor complex, activates the NF-kappa-B and MAPkinase pathways, and induces the transcription of immune-related genes. IL-17F Protein, Human (H161R, HEK293, His) is the recombinant human-derived IL-17F protein, expressed by HEK293, with N-His labeled tag and H161R mutation. The total length of IL-17F Protein, Human (H161R, HEK293, His) is 133 a.a., with molecular weight of ~23 kDa.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-17F protein is a key effector cytokine in innate and adaptive immunity that maintains tissue integrity and protects against microorganisms. It acts through the IL17RA-IL17RC receptor complex, activates the NF-kappa-B and MAPkinase pathways, and induces the transcription of immune-related genes. IL-17F Protein, Human (H161R, HEK293, His) is the recombinant human-derived IL-17F protein, expressed by HEK293, with N-His labeled tag and H161R mutation. The total length of IL-17F Protein, Human (H161R, HEK293, His) is 133 a.a., with molecular weight of ~23 kDa.
Background
IL-17F Protein serves as a key effector cytokine in the innate and adaptive immune systems, crucial for antimicrobial defense and tissue integrity maintenance. Operating through the IL17RA-IL17RC receptor complex, it triggers downstream activation of NF-kappa-B and MAPkinase pathways, leading to the transcriptional activation of various immune-related genes. Primarily associated with Th17 cells, IL-17F induces neutrophil activation, antimicrobial peptide production, and regulates immune tolerance. It forms homodimers and heterodimers with IL-17A, influencing diverse biological processes, from sympathetic innervation to microbiota regulation. The complex interactions and signaling pathways orchestrated by IL-17F underscore its multifaceted role in immune responses and cellular homeostasis.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
Q96PD4 (R31-Q163, H161R)
-
Molecular Construction
-
N-term
-
His
-
IL-17F (R31-Q163, H161R)
Accession # Q96PD4 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL17F; ML1; Interleukin 17F; Interleukin-17F; IL-17F; Cytokine ML-1; ML-1; CANDF6
-
AA Sequence
RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ
-
Predicted Molecular Mass
16.8 kDa
-
Molecular Weight
Approximately 20-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
