IL-17F Protein, Human (H161R, HEK293, His)

IL-17F protein is a key effector cytokine in innate and adaptive immunity that maintains tissue integrity and protects against microorganisms. It acts through the IL17RA-IL17RC receptor complex, activates the NF-kappa-B and MAPkinase pathways, and induces the transcription of immune-related genes. IL-17F Protein, Human (H161R, HEK293, His) is the recombinant human-derived IL-17F protein, expressed by HEK293 , with N-His labeled tag and H161R, , , , mutation. The total length of IL-17F Protein, Human (H161R, HEK293, His) is 133 a.a., with molecular weight of ~23 kDa.

IL-17F Protein serves as a key effector cytokine in the innate and adaptive immune systems, crucial for antimicrobial defense and tissue integrity maintenance. Operating through the IL17RA-IL17RC receptor complex, it triggers downstream activation of NF-kappa-B and MAPkinase pathways, leading to the transcriptional activation of various immune-related genes. Primarily associated with Th17 cells, IL-17F induces neutrophil activation, antimicrobial peptide production, and regulates immune tolerance. It forms homodimers and heterodimers with IL-17A, influencing diverse biological processes, from sympathetic innervation to microbiota regulation. The complex interactions and signaling pathways orchestrated by IL-17F underscore its multifaceted role in immune responses and cellular homeostasis.

Immobilized Human IL-17F (H161R, His) at 10 μg/mL (100 μL/well) can bind Biotinylated Human IL-17 RA Fc-Avi with a linear range of 0.02-0.313 μg/mL.

Human

HEK293

N-His

Q96PD4 (R31-Q163, H161R)

112744  [NCBI]

Full Length of Mature Protein

RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ

Approximately 20-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.