IL-17RB Protein, Human (HEK293, His)

IL-17RB (Interleukin 17 receptor B), a protein encoded by the IL17RB gene, is a receptor for the pro-inflammatory cytokines IL17B and IL17E. IL-17RB expression is high in kidney, pancreas, liver, brain, and intestines. IL-17RB may play a role in hematopoietic cell differentiation and growth. IL-17RB is involved in inflammatory diseases and cancers. IL-17RB Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-17RB (Interleukin 17 receptor B), a protein encoded by the IL17RB gene, is a receptor for the pro-inflammatory cytokines IL17B and IL17E. IL-17RB expression is high in kidney, pancreas, liver, brain, and intestines. IL-17RB may play a role in hematopoietic cell differentiation and growth. IL-17RB is involved in inflammatory diseases and cancers[1][2]. IL-17RB Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags.

Background

IL-17RB (Interleukin 17 receptor B), a 47.9 kDa transmembrane protein (462 aa) that belongs to the IL-17 receptor family, and can be activated by IL-17B. It has been proved to be involved in inflammatory diseases and cancers. IL-17RB is expressed in various endocrine tissues and in epithelial cells in different organs such as kidney and liver and mucosal tissues[1][2][3].
The amino acid sequence of human IL-17RB protein has low homology with mouse IL-17B protein.
IL-17RB has a SEFIR cytoplasmic domain implicated in homotypic dimerization and recruitment of signaling proteins (shared with IL-17RA) and a TRAF6-binding domain (not found in IL-17RA). IL-17B shares its receptor IL-17RB with IL-17E (also known as IL-25) that binds to the heterodimeric IL-17RA/IL-17RB complex. The binding affinity (KD) of IL-17B for IL-17RB is around 30-fold lower than that of IL-17E. It does not bind IL-17, IL-17C and IL-17F. Interleukin-17 (IL-17) plays a pivotal role in inflammatory diseases and cancers. IL-17 acts its role through IL-17 receptor (IL-17R). The IL-17R family are single transmembrane proteins that include the subtype receptors of IL-17RA to IL-17RE. Upon ligand binding, IL-17RB activates the canonical NK-κB pathway as well as ERK, JNK, and p38. Moreover, TRAF6 binds to IL-17RB independently of its ligand and participates in IL-17RB-dependent NF-κB activation[1][2][3].
It is reported that IL-17RB expression is significantly increased in gastric cancer tissues. Moreover, overexpression of IL-17RB is strongly associated with metastasis and inversely correlates with progression-free survival in pancreatic cancer. IL-17RB can enhance thyroid cancer cell invasion and metastasis via ERK1/2 pathway-mediated MMP-9 expression[1]. By using a rodent ortholog of IL-17BR as a probe, IL-17BR message was found to be drastically up-regulated during intestinal inflammation elicited by indomethacin treatment in rats[2]. IL-17RB expression in human innate type 2 lymphocytes, natural killer T (NKT) cells, and Th2 cells suggests a potential role in immune cells[3].

In Vitro

IL-17RB Protein, Human (10 μg/mL; 72 hours) preincubated with IL-2 plus IL-25 for 30 min before addition to the PBMC cultures, the result shows IL-17RB inhibits IL-5 production[4].

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Protein Length

    Extracellular Domain

  • Synonyms

    IL17RB; Interleukin-17B Receptor; Prev. IL17BR; IL-17B Receptor; EVI27; IL-17Rh1; CRL4; IL-17RB; IL17RH1; Interleukin 17 Receptor Homolog 1; Interleukin-17 Receptor B; Interleukin 17B Receptor; IL-17 Receptor Homolog 1; Cytokine Receptor CRL4; Cytokine Re

  • AA Sequence

    REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVTGDSEGATVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPLDNNKSKPGG

  • Predicted Molecular Mass

    30.7 kDa

  • Molecular Weight

    Approximately 38-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00