IL-22 Protein, Human (Biotinylated, HEK293, His-Avi)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. IL-22 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived IL-22 protein, expressed by HEK293 , with N-His, N-Avi labeled tag. The total length of IL-22 Protein, Human (Biotinylated, HEK293, His-Avi) is 146 a.a., with molecular weight of 25-35 kDa.

IL-22 Protein assumes a pivotal role in modulating tissue responses during inflammation, demonstrating a crucial involvement in the regeneration of epithelial cells to preserve barrier function following injury and forestall further tissue damage. Unlike most cytokines, IL-22 exerts no influence on immune cells, relying on a heterodimeric receptor comprising the specific IL22RA1 receptor, found on non-immune cells in various organs, and the shared subunit IL10RB. The binding of IL-22 to IL22RA1 activates the tyrosine kinases JAK1 and TYK2, subsequently triggering STAT3 activation. This, in turn, promotes cell survival and proliferation through the STAT3, ERK1/2, and PI3K/AKT pathways, contributing to the phosphorylation of GSK3B at 'Ser-9' and CTTN. Additionally, IL-22 fosters epithelial cell spreading.

Immobilized Biotinylated Human IL-22 His-Avi at 1 μg/mL (100 μL/well)on streptavidin precoated (0.5 μg/well) plate. can bind Human IL-22 Antibody with a linear range of 0.1-4 ng/mL.

Human

HEK293

N-His;N-Avi

Q9GZX6 (A34-I179)

50616  [NCBI]

Full Length of Mature Protein

Biotin

APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.