1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-22
  5. IL-22 Protein, Mouse (His)

IL-22 Protein is an secreted IL-10 family cytokine that take part in inflammation responses, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells. IL22 promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 Protein, Mouse (His) is the recombinant mouse-derived IL-22 protein, expressed by E. coli , with N-6*His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
Muestra gratis   Apply now
2 μg En stock
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

  • Referencias

Descripciòn

IL-22 Protein is an secreted IL-10 family cytokine that take part in inflammation responses, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells. IL22 promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 Protein, Mouse (His) is the recombinant mouse-derived IL-22 protein, expressed by E. coli , with N-6*His labeled tag.

Background

IL-22 is a secreted IL-10 family cytokine that plays a critical role in modulating tissue responses during inflammation, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells[1][2][3][4].
IL-22 is produced by several T cells, ILC3, neutrophils and macrophages, IL-22 has a specific receptor which is composed of IL-22R1 and IL-10R2, presenting on non-immune cells in many organs. Ligation of IL22RA1 with IL22 induces activation of the tyrosine kinases JAK1 and TYK2, which activates STAT3, and p38 MAPK, in turn, promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 promotes phosphorylation of GSK3B at 'Ser-9' and CTTN as well[5].
IL-22 gets positive regulation from IL-23, IL-1β, IL-7, AhR and Notch, IL-22 gets negative regulation from IL-22BP, TGF-β, IL-27, ICOS, c-Maf and IL-25[6].

Actividad biológica

Measured by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The ED50 for this effect is 106.7 pg/mL, corresponding to a specific activity is 9.3721×106 units/mg.

  • Measured by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The ED50 for this effect is 106.7 pg/mL, corresponding to a specific activity is 9.3721×106 units/mg determined by ELISA.
Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

Q9JJY9 (L34-V179)

Gene ID
Molecular Construction
N-term
6*His
IL-22 (L34-V179)
Accession # Q9JJY9
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuIL-22; Cytokine Zcyto 18; IL-TIF
AA Sequence

LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV

Predicted Molecular Mass
18.6 kDa
Peso molecular

Approximately 19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Pureza
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación
Referencias

IL-22 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

IL-22 Protein, Mouse (His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
IL-22 Protein, Mouse (His)
Cat. No.:
HY-P7079A
Cantidad:
MCE Japan Authorized Agent: