Copy Link Print Information

IL-3R alpha/CD123 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

FITC-tagged IL-3R α/CD123 is a cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes, and B lymphocytes, regulating their production and differentiation. IL-3R alpha/CD123 Protein, Human (HEK293, His) is the recombinant human-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-3R alpha/CD123 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-3R alpha/CD123 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-3R alpha/CD123 Protein, Human (HEK293, His)
  • IL-3R alpha/CD123 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FITC-tagged IL-3R α/CD123 is a cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes, and B lymphocytes, regulating their production and differentiation. IL-3R alpha/CD123 Protein, Human (HEK293, His) is the recombinant human-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

IL-3R alpha/CD123 Protein serves as a cell surface receptor for IL3 and is expressed on hematopoietic progenitor cells, monocytes, and B-lymphocytes, exerting control over the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Upon ligand stimulation, it rapidly undergoes heterodimerization with IL3RB, leading to the phosphorylation and activation of effector proteins, including JAK2 and PI3K. These activated pathways play a crucial role in signaling cell proliferation and differentiation. JAK2 activation further initiates a STAT5-mediated transcriptional program, contributing to the regulation of cellular functions. The receptor interacts with its ligand, IL3, and forms a heterodimer consisting of an alpha and a beta subunit. Notably, the beta subunit is shared among the receptors for IL3, IL5, and GM-CSF.

Verified Bioactivity

1. Measured by its binding ability in a functional ELISA. When Recombinant Human IL-3 is present at 1 μg/mL can bind Recombinant IL-3 R alpha /CD123. The ED50 for this effect is ≤33.72 ng/mL.
2. Loaded Anti-Human CD123 Antibody on Pro-A Biosensor, can bind Recombinant Human IL-3RA with an affinity constant of 6.73 nM as determined in BLI assay.
3.Loaded  Mipletamig (HY-P990928) on ProA biosensor, can bind IL-3R alpha/CD123 Protein, Human (HEK293, His) with an affinity constant of 2.069E-07 M as determined in  BLI assay.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Human IL-3 protein is represent at 1 µg/mL (100 µL/mL) can bind Recombinant Human IL-3R alpha Protein. The ED50 for this effect is 20.44 ng/mL.

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded  Mipletamig (HY-P990928) on ProA biosensor, can bind IL-3R alpha/CD123 Protein, Human (HEK293, His) with an affinity constant of 2.069E-07 M as determined in  BLI assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P26951-1 (T19-R305)

  • Gene ID
    3563  [NCBI]
  • Molecular Construction
    • N-term
    • IL-3Rα (T19-R305)
      Accession # P26951-1
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    IL3RA; IL-3R-Alpha; Interleukin 3 Receptor Subunit Alpha; IL3R; CD123; HIL-3Ra; Interleukin 3 Receptor, Alpha (Low Affinity); IL3RAY; Interleukin-3 Receptor Subunit Alpha; IL-3RA; IL-3 Receptor Subunit Alpha; IL3RX; IL-3R Subunit Alpha; IL3RY; CD123 Antig

  • AA Sequence

    TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR

  • Molecular Weight

    Approximately 40-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Human IL-3 protein is represent at 1 µg/mL (100 µL/mL) can bind Recombinant Human IL-3R alpha Protein. The ED50 for this effect is 20.44 ng/mL.

  • 1/16

    MedChemExpress Validation
     Loaded  Mipletamig (HY-P990928) on ProA biosensor, can bind IL-3R alpha/CD123 Protein, Human (HEK293, His) with an affinity constant of 2.069E-07 M as determined in  BLI assay.

  • IL-3R alpha/CD123 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IL-3R alpha/CD123 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-3R alpha/CD123 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-3R alpha/CD123 Protein, Human (HEK293, His)
  • IL-3R alpha/CD123 Protein, Human (HEK293, His) Product Image