IL-3R alpha/CD123 Protein, Human (HEK293, His)

FITC-tagged IL-3R α/CD123 is a cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes, and B lymphocytes, regulating their production and differentiation. IL-3R alpha/CD123 Protein, Human (HEK293, His) is the recombinant human-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-6*His labeled tag.

IL-3R alpha/CD123 Protein serves as a cell surface receptor for IL3 and is expressed on hematopoietic progenitor cells, monocytes, and B-lymphocytes, exerting control over the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Upon ligand stimulation, it rapidly undergoes heterodimerization with IL3RB, leading to the phosphorylation and activation of effector proteins, including JAK2 and PI3K. These activated pathways play a crucial role in signaling cell proliferation and differentiation. JAK2 activation further initiates a STAT5-mediated transcriptional program, contributing to the regulation of cellular functions. The receptor interacts with its ligand, IL3, and forms a heterodimer consisting of an alpha and a beta subunit. Notably, the beta subunit is shared among the receptors for IL3, IL5, and GM-CSF.

1. Measured by its binding ability in a functional ELISA. When Recombinant Human IL-3 is present at 1 μg/mL can bind Recombinant IL-3 R alpha /CD123. The ED₅₀ for this effect is ≤33.72 ng/mL.
2. Loaded Anti-Human CD123 Antibody on Pro-A Biosensor, can bind Recombinant Human IL-3RA with an affinity constant of 6.73 nM as determined in BLI assay.
3.Loaded  Mipletamig (HY-P990928) on ProA biosensor, can bind IL-3R alpha/CD123 Protein, Human (HEK293, His) with an affinity constant of 2.069E-07 M as determined in  BLI assay.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Human IL-3 protein is represent at 1 µg/mL (100 µL/mL) can bind Recombinant Human IL-3R alpha Protein. The ED₅₀ for this effect is 20.44 ng/mL.
• 
  Loaded  Mipletamig (HY-P990928) on ProA biosensor, can bind IL-3R alpha/CD123 Protein, Human (HEK293, His) with an affinity constant of 2.069E-07 M as determined in  BLI assay.

Human

HEK293

C-6*His

P26951-1 (T19-R305)

3563  [NCBI]

Extracellular Domain

TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR

Approximately 40-72 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.