LILRB1/CD85j/ILT2 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The LILRB1/CD85j/ILT2 protein is a receptor for class I MHC antigens and recognizes multiple HLA alleles and H301/UL18 (human cytomegalovirus MHC homolog). Ligand binding induces inhibitory signals that downregulate immune responses. LILRB1/CD85j/ILT2 Protein, Human (HEK293, His) is the recombinant human-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The LILRB1/CD85j/ILT2 protein is a receptor for class I MHC antigens and recognizes multiple HLA alleles and H301/UL18 (human cytomegalovirus MHC homolog). Ligand binding induces inhibitory signals that downregulate immune responses. LILRB1/CD85j/ILT2 Protein, Human (HEK293, His) is the recombinant human-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The LILRB1/CD85j/ILT2 Protein serves as a receptor for class I MHC antigens, demonstrating recognition across a broad spectrum of HLA-A, HLA-B, HLA-C, HLA-G, and HLA-F alleles. Additionally, it acts as a receptor for H301/UL18, a human cytomegalovirus class I MHC homolog. Ligand binding induces inhibitory signals, leading to the down-regulation of the immune response. The engagement of LILRB1 by class I MHC molecules on natural killer cells or T-cells protects target cells from lysis, and interaction with HLA-B or HLA-E inhibits FCER1A signaling and serotonin release. Moreover, LILRB1 inhibits FCGR1A-mediated cellular responses, including phosphorylation of proteins and mobilization of intracellular calcium ions. It recognizes HLA-G in complex with B2M/beta-2 microglobulin and a nonamer self-peptide, triggering the secretion of growth-promoting factors by decidual NK cells. Additionally, it reprograms B cells toward an immune suppressive phenotype. LILRB1 binds PTPN6 when phosphorylated and interacts with FCER1A, FCGR1A, and the UL18 protein from human cytomegalovirus. It also interacts with peptide-bound HLA-G-B2M and HLA-F-B2M complexes, highlighting its diverse roles in immune modulation and viral recognition.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human LILRB1/CD85j/ILT2 (HY-P70179) at 2 μg/mL can bind Recombinant Human Angiopoietin-like Protein 7/ANGPTL7 (HY-P700852). The ED50 for this effect is 0.1069 μg/mL.
MCE Validation Data
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
ADJ55949.1 (G24-H458)
-
Molecular Construction
-
N-term
-
LILRB1 (G24-H458)
Accession # ADJ55949.1 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
LILRB1; CD85 Antigen-Like Family Member J; Leukocyte Immunoglobulin Like Receptor B1; Myeloid Inhibitory Receptor 7; LIR-1; Leucocyte Ig-Like Receptor B1; MIR-7; ILT-2; ILT2; CD85; LIR1; MIR7; CD85j; Immunoglobulin Heavy Chain Variable Region; PIR-B; Leuk
-
AA Sequence
GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRH
-
Predicted Molecular Mass
48.2 kDa
-
Molecular Weight
Approximately 64-90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (239 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)