MFG-E8 Protein, Human (Biotinylated, sf9, His-Avi)
Based on 1 Customer Validation
MFG-E8 Protein plays a crucial role in maintaining intestinal epithelial homeostasis, facilitating mucosal healing, and contributing to VEGF-dependent neovascularization. It acts as a specific ligand, binding to alpha-v/beta-3 and alpha-v/beta-5 receptors, and participates in the phagocytic removal of apoptotic cells. The protein is also implicated in zona pellucida binding and is a major component of aortic medial amyloid. MFG-E8 Protein, Human (Biotinylated, sf9, His-Avi) is the recombinant human-derived MFG-E8 protein, expressed by Sf9 insect cells , with C-Avi, C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MFG-E8 Protein plays a crucial role in maintaining intestinal epithelial homeostasis, facilitating mucosal healing, and contributing to VEGF-dependent neovascularization. It acts as a specific ligand, binding to alpha-v/beta-3 and alpha-v/beta-5 receptors, and participates in the phagocytic removal of apoptotic cells. The protein is also implicated in zona pellucida binding and is a major component of aortic medial amyloid. MFG-E8 Protein, Human (Biotinylated, sf9, His-Avi) is the recombinant human-derived MFG-E8 protein, expressed by Sf9 insect cells , with C-Avi, C-His labeled tag.
Background
The MFG-E8 protein is involved in multiple essential functions, including the maintenance of intestinal epithelial homeostasis and the facilitation of mucosal healing. It aids in VEGF-dependent neovascularization and contributes to the phagocytic removal of apoptotic cells in various tissues. Acting as a specific ligand, it binds to the alpha-v/beta-3 and alpha-v/beta-5 receptors, and it also has the ability to bind to cell surfaces enriched with phosphatidylserine, independently of receptors. Furthermore, it serves as a zona pellucida-binding protein that potentially plays a role in gamete interaction. Additionally, the MFG-E8 protein is a main constituent of aortic medial amyloid.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-Avi;C-His
-
Accession
Q08431-1 (L24-C387)
-
Molecular Construction
-
N-term
-
MFG-E8 (L24-C387)
Accession # Q08431-1 -
Avi-His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Conjugation
Biotin
-
Synonyms
MFGE8; HP47; Prev. SPAG10; Breast Epithelial Antigen BA46; MFG-E8; Sperm Associated Antigen 10; SED1; Sperm Surface Protein HP47; Lactadherin; HMFG; HsT19888; MFGM; OAcGD3S; O-Acetyl Disialoganglioside Synthase; EDIL1; Milk Fat Globule-EGF Factor 8; BA46; Medin; Milk Fat Globule EGF And Factor V/VIII Domain Containing; Milk Fat Globule-EGF Factor 8 Protein
-
AA Sequence
LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGLENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC
-
Predicted Molecular Mass
44.1 kDa
-
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, 10% glycerol, 0.2 M Arginine, 0.01% Tween 20, pH 8.5, 5% trehalose, 5% mannitol, 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O[10.1]. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
