MICA Protein, Human (Biotinylated, HEK293, His-Avi)
MHC class I chain-related protein A (MICA) is a highly polymorphic major histocompatability complex class I chain-related protein A. MICA is expressed on the cell surface and is a ligand for the NKG2-D type II integral membrane protein receptor and functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells, MICA has been associated with susceptibility to psoriasis 1 and psoriatic arthritis. MICA Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
MHC class I chain-related protein A (MICA) is a highly polymorphic major histocompatability complex class I chain-related protein A. MICA is expressed on the cell surface and is a ligand for the NKG2-D type II integral membrane protein receptor and functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells, MICA has been associated with susceptibility to psoriasis 1 and psoriatic arthritis. MICA Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
MHC class I chain-related protein A (MICA) is a highly polymorphic major histocompatability complex class I chain-related protein A. MICA is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. MICA is a ligand for the NKG2-D type II integral membrane protein receptor and functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations of MICA have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma[1][2].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
Q96QC4 (E24-Q308)
-
Molecular Construction
-
N-term
-
MICA (E24-Q308)
Accession # Q96QC4 -
8*His-Avi
-
C-term
-
-
Protein Length
Partial
-
Conjugation
Biotin
-
Synonyms
MICA; MHC Class I Related Chain A Isoform B1; MHC Class I Polypeptide-Related Sequence A; MHC Class I Related Chain A Isoform B2; PERB11.1; MHC Class I Related Chain A Isoform C; Major Histocompatibility Complex Class I Chain-Related Protein A; MHC Class
-
AA Sequence
EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
-
Predicted Molecular Mass
35.8 kDa
-
Molecular Weight
Approximately 52-68 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)