OX40 Ligand/TNFSF4 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family. OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs. OX40 Ligand/TNFSF4 Protein, Human (HEK293, His) is a recombinant human OX40 Ligand (Q51-L183) with N-terminal 6*His tag, which is produced in HEK293.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa[1]. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family. OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2]. OX40 Ligand/TNFSF4 Protein, Human (HEK293, His) is a recombinant human OX40 Ligand (Q51-L183) with N-terminal 6*His tag, which is produced in HEK293.

Background

OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa[1]. OX40 Ligand is expressed on antigen-presenting cells, such as B cells, dendritic cells (DCs), and macrophages, and airway smooth muscle cells[3]. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family.
OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2].
Human OX40 Ligand shares <70% aa sequence identity with mouse, rat and rabbit.
The interaction between OX40 Ligand with OX40 is essential for the generation of antigen-specific memory T cells, and induces host antitumor immunity[4]. But the over-upregulation of OX40 and OX40L may induce abnormal activation of Tfh cells and excessive production of autoantibodies, which leads to autoimmune disease[1].

In Vitro

OX40 Ligand (human, 100 ng/mL, 7 days, added into DC-T cell cultures at days 0 and 4) inhibits the generation of IL-10-producing T cells induced by immature DCs and DCs treated with IL-10 and IFN-α[5].

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • OX40L (Q51-L183)
      Accession # P23510-1
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TNFSF4; Tumor Necrosis Factor (Ligand) Superfamily Member 4; Prev. TXGP1; Tumor Necrosis Factor Superfamily Member 4; Tumor Necrosis Factor Ligand Superfamily Member 4; Tumor Necrosis Factor Ligand 2B; OX-40L; OX40 Antigen Ligand; CD252; CD252 Antigen; Gp

  • AA Sequence

    QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

  • Predicted Molecular Mass

    16.3 kDa

  • Molecular Weight

    Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00